Bu çalışma Mitsubishi Vakfı, Takeda Bilim Vakfı, JST PRESTO ve JSPS KAKENHI tarafından hibe numarası 16H06144 tarafından desteklendi.

Tüm deneysel prosedürler, Tokyo Üniversitesi&#39;ndeki hayvan deney etik komitesinin onayı ve Tokyo Üniversitesi tarafından laboratuar hayvanlarının bakımı ve kullanımı ile ilgili kurallarına uygun olarak gerçekleştirildi. 1. Çözümlerin Hazırlanması <ol><li> 0.01 M Fosfat Tamponlu Tuz (PBS) hazırlayın: 1 L damıtılmış suya bir PBS tableti (0.14 M NaCl, 0.0027 M KCl, 0.010 M PO 4 3- , pH 7.4) ilave edin ve tamamen eriyene kadar oda sıcaklığında karıştırın. </li><li> PBS içinde% 4 paraformaldehit (PFA) hazırlayın: 100 mL PBS&#39;ye 4 g PFA ekleyin. Çözeltiyi tamamen çözülene kadar 60 ° C&#39;de karıştırın. <ol><li> PFA&#39;nın PBS&#39;de çözülmesinden sonra, çözeltinin pH&#39;ını 1 N sodyum hidroksit (NaOH) ile 7.4&#39;e ayarlayın. Ardından, buz üzerinde soğutun ve partiküler maddeleri temizlemek için çözeltiyi bir filtre kağıdından geçirin. 4 ° C&#39;de saklayın. Dikkat: Bu reaktifleri kullanırken dikkatli olun. SapDikkatli olun ve eldivenleri, emniyet gözlükleri ve laboratuar önlüğü kimyasal bir başlık altına alın. NOT: 2 d içerisinde hazırlanan yeni% 4 PFA solüsyonu kullanın. </li></ol></li><li> % 0,3 Triton X-100 (PBST) ile desteklenmiş 0.01 M PBS hazırlayın: 3 ml Triton X-100 ila 997 mL PBS ekleyin. Çözeltiyi, tamamen eriyene kadar karıştırın. </li><li> % 1 ve% 5 bloke edici çözelti hazırlayın:% 5 engelleme çözeltisi hazırlamak için 200 mL PBST&#39;ye 10 gr yağsız süt ekleyin. Tamamen çözünene kadar oda sıcaklığında karıştırın. % 1 bloklama solüsyonu hazırlamak için PBST ile% 5 engelleme solüsyonunu beş kez seyreltin. </li></ol> 2. Parasagittal OB Bölümlerinin Hazırlanması <ol><li> 1-2 haftalık hayvanlar kullanın. Bu yaş grupları, aşağıdaki deneyler için uygundur, çünkü glomerüller açıkça görülebilir ve beyin kafatası ile kesilebilir. </li><li> Hayvanı intraperitoneal pentobarbital enjeksiyonu (50 mg / kg vücut ağırlığı) ile anestezi altına alınız. Hayvanı transcardially buz soğukluğunda% 4 P ile besleyinPBS&#39;de FA. Kimyasal kaputun altında dikkatlice tutun ve eldivenleri, güvenlik gözlükleri ve laboratuar önlüğü kullanın. </li><li> Perfüzyon sonrasında, başını makasla kesin ve cildi dikkatli bir şekilde çıkarın. Ardından, üst ve alt dişler arasındaki boşluğa makas bıçağı takın ve alt çene kemiği kaldırmak için yatay olarak kesiniz. OB ve OE dahil olmak üzere koku alma dokusunu terketmek için fazla doku forseps ve makasla alın. NOT: OB&#39;yi çevreleyen kafatasını çıkarmayın, çünkü medial glomerülleri dikey olarak hizalanmış tutar. </li><li> Burun boşluğundaki havayı çıkarmak için koku alma dokusunu PBS&#39;ye daldırın. Beynin arka kısmını dikey olarak kesin ve koku alma dokusunu, kesme yüzü aşağı bakacak şekilde yerleştirme kalıbının altına yerleştirin. Kalıbı Optimal Kesme Sıcaklığı (OCT) bileşiği ile doldurun ve ardından kalıp sıvı nitrojene batırın. <ol><li> Bileşikteki doku tamamen donduktan sonra, kriyolarda inkübe edin-20 ° C&#39;de 1 saat bekletme. </li></ol></li><li> Bir kriyostat ile OB&#39;nin seri parasagittal kesitlerini (10 μm) yapın ve bunları MAS kaplı cam slaytlara tutturarak toplayın. Yapışkan olduktan sonra, slaytları bir üfleme kurutucu ile hemen kurutun. </li></ol> 3. Gün 1. OB Dilimlerinin Dörtlü İmmün Sıyırılması <ol><li> Slaytları 5 dakika oda sıcaklığında PBS ile yıkayın. 3 kez tekrarlayın. </li><li> Slaytları, oda sıcaklığında% 5 engelleme solüsyonuyla 1 saat inkübe ederek spesifik olmayan bağlanma yerlerini bloke edin. </li><li> Slaytları O / N, oda sıcaklığında% 1 engelleme solüsyonunda birincil antikorların (her bir slaytta 400 μL) bir kokteyl ile inkübe edin. Aşağıdaki primer antikorları kullanın: kobay anti Kirrel2 antikoru (1: 1000), keçi anti-Semaforin-7A (Sema7A) antikoru (1: 500), sıçan anti-OL-protokadherin (OLPC) antikoru (1: 500) Ve fare anti-veziküler glutamat taşıyıcı 2 (VGLUT2) antikoru (1: 500). </li></ol> 4. Gün 2. OB&#39;nin Dörtlü İmmün Sıyırılmasıdilimler <ol><li> Birincil antikor çözeltisini atın ve slaytları RT&#39;de PBST ile 5 dakika boyunca yıkayın. 3 kez tekrarlayın. </li><li> Slaytları, oda sıcaklığında PBS içinde ikincil antikorların (her bir slayttan 400 μL) bir kokteyl ile 1 saat inkübe edin. Aşağıdaki ikincil antikorları kullanın: eşek anti-fare Alexa Fluor 405 (1: 400), eşek anti-keçi Alexa Fluor 488 (1: 400), eşek anti-gine domuz Alexa Fluor 555 (1: 400) ve eşek anti- Sıçan Alexa Fluor 647 (1: 400). NOT: Tüm ikincil antikorlar aynı konakçı türe ait olmalıdır. Her birincil antikor için ikincil antikorların floresansının farklı bir dalga boyu seçerek dalga boylarının örtüşmesini sağlamayın. </li><li> Çözümü atın ve slaytları oda sıcaklığında PBS ile 5 dakika boyunca yıkayın. 3 kez tekrarlayın. </li><li> Lamelleri montaj ortamı ile slaytlar üzerine monte edin. Bunun için, her slayt üzerine 2 damla montaj malzemesi uygulayın ve sonra hava kabarcıklarını giderecek şekilde lamel koyun. </li></ol> 5. Yoğunluk Measurements <ol><li> Floresan bir mikroskop ile floresan görüntü elde edin. Aşağıdaki filtre küplerini kullanın: Alexa Fluor 405 sinyalleri, GFP filtre küpü için (470/40 nm uyarılma, 525/50 nm emisyon, DIP filtresi küpü (360/40 nm uyarılma, 460/50 nm emisyon ve 400 nm dikroik ayna) Ve Alexa Fluor 555 ve Cy5 filtre küpü için (620/60 nm uyarılma, 700) 495 nm dikey renk aynası) için Alexa Fluor 488, TRITC filtre küpü (545/25 nm uyarılma, 605 / 70nm emisyon ve 565 nm dikroik ayna) / 75 nm emisyon ve 600 nm dikroik ayna) Alexa Fluor 647 için. Not: Görüntünün doygunluk olmadan floresan sinyalleri elde etmek için pozlama süresini ayarlayın. </li><li> Glomerüler yapıyı VGLUT2&#39;nin immünofloresan sinyalleri ile tanımlayın. ImageJ ile glomeruller içindeki akson sıralama moleküllerinin boyama yoğunluğunu ölçün. </li></ol> 6. Veri Analizi <ol><li> Akson sıralama moleküllerinin boyama yoğunluklarından arka plan sinyallerini çıkarın. </li><li> HazırlayınEkspresyon veri matrisi, akson ayırma moleküllerinden ve glomerüllerden oluşan sıralardan oluşan sütunlara sahiptir. </li><li> Hazırlanan ifade veri setini kullanarak bir ana bileşen analizi (PCA) yapın. Ardından, her temel bileşenin PCA puanlarını, katkı oranlarını ve faktör yüklemelerini elde edin. </li></ol>

<ol>
	<li>Mori, K., Sakano, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=How+is+the+olfactory+map+formed+and+interpreted+in+the+mammalian+brain?.">How is the olfactory map formed and interpreted in the mammalian brain?.</a> Annu Rev Neurosci. 34, 467-499 (2011).</li><li>Takeuchi, H., Sakano, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Neural+map+formation+in+the+mouse+olfactory+system.">Neural map formation in the mouse olfactory system.</a> Cell Mol Life Sci. 71, 3049-3057 (2014).</li><li>Mombaerts, P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Visualizing+an+olfactory+sensory+map.">Visualizing an olfactory sensory map.</a> Cell. 87, 675-686 (1996).</li><li>Feinstein, P., Mombaerts, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+contextual+model+for+axonal+sorting+into+glomeruli+in+the+mouse+olfactory+system.">A contextual model for axonal sorting into glomeruli in the mouse olfactory system.</a> Cell. 117, 817-831 (2004).</li><li>Ishii, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Monoallelic+expression+of+the+odourant+receptor+gene+and+axonal+projection+of+olfactory+sensory+neurones.">Monoallelic expression of the odourant receptor gene and axonal projection of olfactory sensory neurones.</a> Genes Cell. 6, 71-78 (2001).</li><li>Nakashima, A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Agonist-independent+GPCR+activity+regulates+anterior-posterior+targeting+of+olfactory+sensory+neurons.">Agonist-independent GPCR activity regulates anterior-posterior targeting of olfactory sensory neurons.</a> Cell. 154, 1314-1325 (2013).</li><li>Serizawa, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+neuronal+identity+code+for+the+odorant+receptor-specific+and+activity-dependent+axon+sorting.">A neuronal identity code for the odorant receptor-specific and activity-dependent axon sorting.</a> Cell. 127, 1057-1069 (2006).</li><li>Kaneko-Goto, T., Yoshihara, S., Miyazaki, H., Yoshihara, Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=BIG-2+mediates+olfactory+axon+convergence+to+target+glomeruli.">BIG-2 mediates olfactory axon convergence to target glomeruli.</a> Neuron. 57, 834-846 (2008).</li><li>Ihara, N., Nakashima, A., Hoshina, N., Ikegaya, Y., Takeuchi, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Differential+expression+of+axon-sorting+molecules+in+mouse+olfactory+sensory+neurons.">Differential expression of axon-sorting molecules in mouse olfactory sensory neurons.</a> Eur J Neuro. 44, 1998-2003 (2016).</li><li>Williams, E. O., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Delta+Protocadherin+10+is+Regulated+by+Activity+in+the+Mouse+Main+Olfactory+System.">Delta Protocadherin 10 is Regulated by Activity in the Mouse Main Olfactory System.</a> Front Neural Circuits. 5, 9 (2011).</li><li>Brunet, L. J., Gold, G. H., Ngai, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=General+anosmia+caused+by+a+targeted+disruption+of+the+mouse+olfactory+cyclic+nucleotide-gated+cation+channel.">General anosmia caused by a targeted disruption of the mouse olfactory cyclic nucleotide-gated cation channel.</a> Neuron. 17, 681-693 (1996).</li></ol>

Yazarlar rakip mali çıkarları beyan etmiyor.

Parasagittal OB bölümlerinin dörtlü immün boyası, daha fazla sayıda glomerül içerisinde eş zamanlı olarak dört akson sıralama molekülünün ekspresyon seviyelerinin görselleştirilmesini ve sayısallaştırılmasını sağladı. Bu çok değişkenli veriyi PCA ile analiz ederek, bu moleküllerin ifadesinin özellikleri spekülasyona tabi tutulabilir. Başarılı bir boyama için, doku örneği hazırlığı kritik öneme sahiptir. Bazı protokoller dokuların% 4&#39;lük PFA i...

Gelişme sırasında nöronlar, normal beyin fonksiyonu için kritik olan uygun sinirsel devreleri oluşturmak için birbirleriyle tam olarak bağlantılıdır. Beyindeki anormal sinirsel devrelerin, otizm ve şizofreni gibi zihinsel rahatsızlıkların nedeni olduğu düşünülürse, sinirsel devre oluşum mekanizmalarını anlamak, sinirbilimi alanındaki en büyük zorluklardan biridir. Fare olfaktör sisteminde, Olfaktor Epitelyumdaki (OE) her Koku Giderici Nöron (OSN), yalnızca bir fonksiyonel Olfaktör Reseptör (OR) genini ifade eder ve aynı OR&#39;yi ifade eden OSN&#39;ler, aksonları belirli klonlama noktalarına, Koku dolabı (OB) 1 , 2 . Fare koku sistemi, sinirsel devre oluşumunun moleküler mekanizmalarını incelemek için mükemmel bir model sistemidir çünkü araştırmacılar OR ifadesini belirli bir sUbtype OSNs ve net glomerüler yapılar olarak OSN aksonların projeksiyon yerleri görselleştirmek. OSN projeksiyonunun dikkati çeken bir özelliği, OR&#39;lerin OSB aksonlarını OB 3 , 4 , 5 , 6&#39;ya yansıtmada öğretici rol oynamasıdır. Daha spesifik olarak, OSN aksonları yaklaşık hedef bölgelere yönlendirildikten sonra, OR&#39;ye bağımlı bir şekilde glomerulus oluşturmak üzere ayrılırlar. Önceki çalışmalar, OR moleküllerinin glomerüler ayrımı düzenleyen akson ayırma moleküllerinin ekspresyonunu kontrol ettiğini göstermiştir 7,8. Dahası, biriken kanıtlar, OR moleküllerinin akson sıralama moleküllerinin benzersiz bir kombinasyonu ile nöronal kimlik kodunu ürettiklerini göstermektedir 9 . Dolayısıyla, VEYA&#39;ya bağlı glomerüler ayrışmanın mekanizmasını anlamak için, akson sıralama molekülünün ekspresyon profillerinin karakterize edilmesi gereklidirOSK&#39;larda ecules. Flüoresan immün boyama, spesifik genlerin ekspresyonunu görselleştirmek için yaygın bir yöntemdir. Akson ayırma moleküllerinin proteinleri ağırlıklı olarak OSN aksonlarına lokalize olduğundan, araştırmacılar OSN&#39;lerdeki ifade şekillerini karakterize etmek için OB bölümlerini kullanmaları gerekir. OB&#39;nin koronal kesitlemesi immün boyama için rutin olarak kullanılmıştır. Bununla birlikte, bu preparat aynı OB bölümünde anterior-posterior eksen boyunca topografik bilgiyi kaybeder. Bu nedenle, OB&#39;nin medial tarafında aynı OB bölümünde olabildiğince çok çevreleyen glomerül yükleyebilen parasagital bir preparat geliştirdik. Birden fazla antikor kullanılarak immün boyama ile bir araya getirilen bu preparasyon, akson ayırma moleküllerinin ekspresyon modellerinin karşılaştırılması ve analiz edilmesine izin verir ve OB bölümleri arasında renk değişikliği yapmaz. Ayrıca, immünhistokimyasal bir boyama yöntemi, PFA ile fiksasyon sonrası uygulanmadan sunulmuştur.Sekroz tedavisi. Bu yöntem, araştırmacıların çok değişkenli veri analizi için yeterli yüksek kaliteli boyama verilerini elde etmelerini sağlar. Burada sunulan protokoller, olfaktör sinirsel devre oluşumunu inceleyen araştırmacılar için güçlü yöntemlerin ayrıntılarını verecektir.

<table><tbody><tr><td>Phosphate-Buffered Saline (PBS) Tablets, pH7.4</td><td>TAKARA BIO</td><td>T9181</td><td></td></tr><tr><td>Skim Milk</td><td>nacalai tesque</td><td>31149-75</td><td></td></tr><tr><td>goat anti-Sema7A antibody</td><td>R&amp;amp;D Systems</td><td>AF2068</td><td></td></tr><tr><td>rat anti-OLPC antibody</td><td>Merck Millipore</td><td>MABT20</td><td></td></tr><tr><td>mouse anti-VGLUT2 antibody</td><td>Merck Millipore</td><td>MAB5504</td><td></td></tr><tr><td>goat anti-BIG-2 antibody</td><td>R&amp;amp;D Systems</td><td>AF2205</td><td></td></tr><tr><td>gunea pig anti-Kirrel2 antibody</td><td>Operon Biotechnologies</td><td></td><td>Anti-Kirrel2 antibodies were generated by immunizing guinea pigs with KLH-conjugated synthetic peptides (644-673aa): CRLYRARAGYLTTPHPRAFTSYMKPTSFGP</td></tr><tr><td>donkey anti-mouse Alexa Fluor 405</td><td>Abcam</td><td>ab175658</td><td></td></tr><tr><td>donkey anti-goat Alexa Fluor 488&amp;nbsp;</td><td>Jackson ImmunoResearch</td><td>705-545-003</td><td></td></tr><tr><td>donkey anti-guinea pig Alexa Fluor 555</td><td>Thermo Fisher Scientific</td><td>A21432</td><td></td></tr><tr><td>donkey anti-rat Alexa Fluor 647</td><td>Jackson ImmunoResearch</td><td>712-605-153</td><td></td></tr><tr><td>Paraformaldehyde (PFA)</td><td>Wako</td><td>162-16065</td><td></td></tr><tr><td>MAS coated slide glasses</td><td>MATSUNAMI</td><td>MAS-01</td><td></td></tr><tr><td>forceps</td><td>Fine Science Tools</td><td>11253-27</td><td></td></tr><tr><td>Vannas Spring Scissors</td><td>Fine Science Tools</td><td>15000-00</td><td></td></tr><tr><td>dissecting scissors</td><td>Fine Science Tools</td><td>14090-09</td><td></td></tr><tr><td>fluorescent microscope</td><td>KEYENCE</td><td>BZ-X700</td><td></td></tr><tr><td>DAPI filter cube</td><td>KEYENCE</td><td>OP-87762</td><td></td></tr><tr><td>GFP filter cube</td><td>KEYENCE</td><td>OP-87763</td><td></td></tr><tr><td>TRITC filter cube</td><td>KEYENCE</td><td>OP-87764</td><td></td></tr><tr><td>Cy5 filter cube</td><td>KEYENCE</td><td>OP-87766</td><td></td></tr><tr><td>filter paper</td><td>ADVANTEC</td><td>00011185</td><td></td></tr><tr><td>O.C.T compound</td><td>Sakura Finetek</td><td>M71484</td><td></td></tr></tbody></table>

quadruple immunostaining of the olfactory bulb for visualization of olfactory sensory axon molecular identity codes

Fare koku sistemi, basit anatomik yapısı nedeniyle sinirsel devre oluşum mekanizmalarını incelemek için sıklıkla kullanılır. Bir Koku Giderici Nöron (OSN), tek bir dendrit ve tek bir dalkonsuz akson bulunan iki kutuplu bir hücredir. Bir OSN yalnızca bir Olfaktor Reseptör (OR) geni ifade eder; belirli bir OR türünü ifade eden OSN&#39;ler, aksonlarını Olfaktör Ampul (OB) &#39;de birkaç değişmez glomerül setine yaklaştırır. OSN projeksiyonunun dikkate değer bir özelliği, ifade edilen OR&#39;lerin aksonal projeksiyonda öğretici roller oynamasıdır. ORs, çoklu akson sıralama moleküllerinin ekspresyonunu düzenler ve OSN akson ucunda akson sıralama moleküllerinin kombinatoryal moleküler kodunu üretir. Dolayısıyla, VEYA&#39;ya özgü akson yönlendirici mekanizmaların moleküler mekanizmalarını anlamak için, aynı glomerül içerisinde OSN akson ucunda ifade profillerini karakterize etmek hayati önem taşımaktadır. Bu makalenin amacı, mümkün olduğu kadar çok glomerül toplamak için yöntemler tanıtmaktır.Tek bir OB bölümünde ve birden fazla antikor kullanılarak immün boyamanın gerçekleştirilmesi için. Bu, akson sıralama moleküllerinin ekspresyon modellerinin karşılaştırılması ve analiz edilmesine, OB bölümleri arasında renk değişikliği yapmadan izin verir.

Koku sonrası glomerüler harita ilk küresel hedefleme ve ardından OSN aksonlarının 1 , 2 glomerüler segregasyonu ile oluşur. Glomerüler ayrım, ekspresyon seviyeleri eksprese edilen OR molekülleri 7 tarafından belirlenen akson ayırma moleküllerinin aracılık ettiği yapışkan / itici aksonal etkileşimlerle düzenlenir. Glomerüler ayrıma dahil olan akson ayırma molekülleri, OB <sup class=...

Watch this Scientific Journal Video about Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes at JoVE.com

Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes

Koku duyu nöronları, uygun sinirsel devreleri oluşturmak için çok çeşitli akson sıralama moleküllerini ifade eder. Bu protokol, olfaktör duyu nöronlarının akson ucunda akson sıralama moleküllerinin kombinatoryal ifadelerini görselleştirmek için bir immünohistokimyasal boyama yöntemi tarif eder.

Koku Meşfatının Olfaktör Duyusal Akson Moleküler Kimlik Kodlarının Görselleştirilmesi İçin Dörtlü İmmün Sulanması

The mouse olfactory system is often used to study mechanisms of neural circuit formation&#12288;because of its simple anatomical structure. An Olfactory ...

quadruple-immunostaining-olfactory-bulb-for-visualization-olfactory

Universidad de Cartagena UDEC

Research

JoVE Journal

Neuroscience

7.0K Görüntüleme.  The University of Tokyo.  Koku duyu nöronları, uygun sinirsel devreleri oluşturmak için çok çeşitli akson sıralama moleküllerini ifade eder. Bu protokol, olfaktör duyu nöronlarının akson ucunda akson sıralama moleküllerinin kombinatoryal ifadelerini görselleştirmek için bir immünohistokimyasal boyama yöntemi tarif eder. 

Video: Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes

Lentivirus-mediated Genetic Manipulation and Visualization of Olfactory Sensory Neurons in vivo

Development of a precise olfactory circuit relies on accurate projection of olfactory sensory neuron (OSN) axons to their synaptic 
targets in the olfactory bulb (OB). The molecular mechanisms of OSN axon growth and targeting are not well understood. Manipulating gene expression and subsequent 
visualizing of single OSN axons and their terminal arbor morphology have thus far been challenging. To study gene function at the single cell level within a specified 
time frame, we developed a lentiviral based technique to manipulate gene expression in OSNs in vivo. Lentiviral particles are delivered to OSNs by microinjection 
into the olfactory epithelium (OE). Expression cassettes are then permanently integrated into the genome of transduced OSNs. Green fluorescent protein expression 
identifies infected OSNs and outlines their entire morphology, including the axon terminal arbor. Due to the short turnaround time between microinjection and 
reporter detection, gene function studies can be focused within a very narrow period of development. With this method, we have detected GFP expression within as 
few as three days and as long as three months following injection. We have achieved both over-expression and shRNA mediated knock-down by lentiviral microinjection. 
This method provides detailed morphologies of OSN cell bodies and axons at the single cell level in vivo, and thus allows characterization of candidate gene function 
during olfactory development.

Lentivirus-mediated Genetic Manipulation and Visualization of Olfactory Sensory Neurons in vivo

We present a lentiviral technique for genetic manipulation and visualization of single olfactory sensory neuron axon and its terminal arborization in vivo.

Koku Duyu Nöronlar lentivirüs aracılı Genetik Manipülasyon ve Görselleştirme In vivo</em

Development of a precise olfactory circuit relies on accurate projection of olfactory sensory neuron (OSN) axons to their synaptic 
targets in the ...

Nörobilim

Imaging Odor-Evoked Activities in the Mouse Olfactory Bulb using Optical Reflectance and Autofluorescence Signals

In the brain, sensory stimulation activates distributed populations of neurons among functional modules which participate to the coding of the stimulus. Functional optical imaging techniques are advantageous to visualize the activation of these modules in sensory cortices with high spatial resolution. In this context, endogenous optical signals that arise from molecular mechanisms linked to neuroenergetics are valuable sources of contrast to record spatial maps of sensory stimuli over wide fields in the rodent brain.
Here, we present two techniques based on changes of endogenous optical properties of the brain tissue during activation. First the intrinsic optical signals (IOS) are produced by a local alteration in red light reflectance due to: (i) absorption by changes in blood oxygenation level and blood volume (ii) photon scattering. The use of in vivo IOS to record spatial maps started in the mid 1980's with the observation of optical maps of whisker barrels in the rat and the orientation columns in the cat visual cortex1. IOS imaging of the surface of the rodent main olfactory bulb (OB) in response to odorants was later demonstrated by Larry Katz's group2. The second approach relies on flavoprotein autofluorescence signals (FAS) due to changes in the redox state of these mitochondrial metabolic intermediates. More precisely, the technique is based on the green fluorescence due to oxidized state of flavoproteins when the tissue is excited with blue light. Although such signals were probably among the first fluorescent molecules recorded for the study of brain activity by the pioneer studies of Britton Chances and colleagues3, it was not until recently that they have been used for mapping of brain activation in vivo. FAS imaging was first applied to the somatosensory cortex in rodents in response to hindpaw stimulation by Katsuei Shibuki's group4.
The olfactory system is of central importance for the survival of the vast majority of living species because it allows efficient detection and identification of chemical substances in the environment (food, predators). The OB is the first relay of olfactory information processing in the brain. It receives afferent projections from the olfactory primary sensory neurons that detect volatile odorant molecules. Each sensory neuron expresses only one type of odorant receptor and neurons carrying the same type of receptor send their nerve processes to the same well-defined microregions of &tilde;100&mu;m3 constituted of discrete neuropil, the olfactory glomerulus (Fig. 1). In the last decade, IOS imaging has fostered the functional exploration of the OB5, 6, 7 which has become one of the most studied sensory structures. The mapping of OB activity with FAS imaging has not been performed yet.
Here, we show the successive steps of an efficient protocol for IOS and FAS imaging to map odor-evoked activities in the mouse OB.

This article presents the protocols of intrinsic optical signals and flavoproteins autofluorescence signals imaging to map odor-evoked activities at the surface of the olfactory bulb in mice.

Optik Yansıtma ve Otofloresans Sinyalleri kullanarak, Fare Koku Ampul Görüntüleme Koku-Uyarılmış Etkinlikler

In the brain, sensory stimulation activates distributed populations of neurons among functional modules which participate to the coding of the stimulus. ...

Selective Viral Transduction of Adult-born Olfactory Neurons for Chronic in vivo Optogenetic Stimulation

Local interneurons are continuously regenerated in the olfactory bulb of adult rodents1-3. In this process, called adult neurogenesis, neural stem cells in the walls of the lateral ventricle give rise to neuroblasts that migrate for several millimeters along the rostral migratory stream (RMS) to reach and incorporate into the olfactory bulb. To study the different steps and the impact of adult-born neuron integration into preexisting olfactory circuits, it is necessary to selectively label and manipulate the activity of this specific population of neurons. The recent development of optogenetic technologies offers the opportunity to use light to precisely activate this specific cohort of neurons without affecting surrounding neurons4,5. Here, we present a series of procedures to virally express Channelrhodopsin2(ChR2)-YFP in a temporally restricted cohort of neuroblasts in the RMS before they reach the olfactory bulb and become adult-born neurons. In addition, we show how to implant and calibrate a miniature LED for chronic in vivo stimulation of ChR2-expressing neurons.

Selective Viral Transduction of Adult-born Olfactory Neurons for Chronic in vivo Optogenetic Stimulation

Adult-born neurons of the olfactory bulb can be optogenetically controlled using Channelrhodopsin2-expressing lentiviral injection in the rostral migratory stream and chronic photostimulation with an implanted miniature LED.

Kronik Yetişkin doğmuş Koku Nöronlar Seçici Viral İletimi In vivo Optogenetic Uyarım

Local interneurons are continuously regenerated in the olfactory bulb of adult rodents1-3. In this process, called adult neurogenesis, neural stem cells ...

Whole Mount Immunolabeling of Olfactory Receptor Neurons in the Drosophila Antenna

Odorant molecules bind to their target receptors in a precise and coordinated manner. Each receptor recognizes a specific signal and relays this information to the brain. As such, determining how olfactory information is transferred to the brain, modifying both perception and behavior, merits investigation. Interestingly, there is emerging evidence that cellular transduction and transcriptional factors are involved in the diversification of olfactory receptor neuron. Here we provide a robust whole mount immunological labeling method to assay in vivo olfactory receptor neuron organization. Using this method, we identified all olfactory receptor neurons with anti-ELAV antibody, a known pan-neural marker and Or49a-mCD8::GFP, an olfactory receptor neuron specifically expressed in Nba neuron using anti-GFP antibody.

Whole Mount Immunolabeling of Olfactory Receptor Neurons in the Drosophila Antenna

Herein we describe the process of whole mount immunostaining of Drosophila antennae, which enables us to better understand the molecular mechanisms involved in the diversification of olfactory receptor neurons (ORN)s.

In Koku Reseptör Nöronlar Tüm Dağı ile immün<em&gt; Drosophila</em&gt; Anten

Odorant molecules bind to their target receptors in a precise and coordinated manner. Each receptor recognizes a specific signal and relays this ...

The Olfactory System as a Model to Study Axonal Growth Patterns and Morphology In Vivo

The olfactory system has the unusual capacity to generate new neurons throughout the lifetime of an organism. Olfactory stem cells in the basal portion of the olfactory epithelium continuously give rise to new sensory neurons that extend their axons into the olfactory bulb, where they face the challenge to integrate into existing circuitry. Because of this particular feature, the olfactory system represents a unique opportunity to monitor axonal wiring and guidance, and to investigate synapse formation. Here we describe a procedure for in vivo labeling of sensory neurons and subsequent visualization of axons in the olfactory system of larvae of the amphibian Xenopus laevis. To stain sensory neurons in the olfactory organ we adopt the electroporation technique. In vivo electroporation is an established technique for delivering fluorophore-coupled dextrans or other macromolecules into living cells. Stained sensory neurons and their axonal processes can then be monitored in the living animal either using confocal laser-scanning or multiphoton microscopy. By reducing the number of labeled cells to few or single cells per animal, single axons can be tracked into the olfactory bulb and their morphological changes can be monitored over weeks by conducting series of in vivo time lapse imaging experiments. While the described protocol exemplifies the labeling and monitoring of olfactory sensory neurons, it can also be adopted to other cell types within the olfactory and other systems.

The Olfactory System as a Model to Study Axonal Growth Patterns and Morphology In Vivo

We describe a protocol for in vivo labeling of olfactory sensory neurons by electroporation and subsequent confocal laser-scanning or multiphoton microscopy to visualize neuronal morphology and its development over time.

Bir Model Olarak Koku Sistemi Akson Büyüme Modelleri ve Morfoloji Eğitim için<em&gt; In Vivo</em

The olfactory system has the unusual capacity to generate new neurons throughout the lifetime of an organism. Olfactory stem cells in the basal portion of ...

Whole Mount Labeling of Cilia in the Main Olfactory System of Mice

The mouse olfactory system comprises 6-10 million olfactory sensory neurons in the epithelium lining the nasal cavity. Olfactory neurons extend a single dendrite to the surface of the epithelium, ending in a structure called dendritic knob. Cilia emanate from this knob into the mucus covering the epithelial surface. The proteins of the olfactory signal transduction cascade are mainly localized in the ciliary membrane, being in direct contact with volatile substances in the environment. For a detailed understanding of olfactory signal transduction, one important aspect is the exact morphological analysis of signaling protein distribution. Using light microscopical approaches in conventional cryosections, protein localization in olfactory cilia is difficult to determine due to the density of ciliary structures. To overcome this problem, we optimized an approach for whole mount labeling of cilia, leading to improved visualization of their morphology and the distribution of signaling proteins. We demonstrate the power of this approach by comparing whole mount and conventional cryosection labeling of Kirrel2. This axon-guidance adhesion molecule is known to localize in a subset of sensory neurons and their axons in an activity-dependent manner. Whole mount cilia labeling revealed an additional and novel picture of the localization of this protein.

Cilia of olfactory sensory neurons contain proteins of the signal transduction cascade, but a detailed spatial analysis of their distribution is difficult in cryosections. We describe here an optimized approach for whole mount labeling and en face visualization of ciliary proteins.

Fareler Ana Koku Sistemde Cilia Whole Dağı Etiketleme

The mouse olfactory system comprises 6-10 million olfactory sensory neurons in the epithelium lining the nasal cavity. Olfactory neurons extend a single ...

An Explant System for Time-Lapse Imaging Studies of Olfactory Circuit Assembly in Drosophila

~Neurons are precisely interconnected to form circuits essential for the proper function of the brain. The Drosophila olfactory system provides an excellent model to investigate this process since 50 types of olfactory receptor neurons (ORNs) from the antennae and maxillary palps project their axons to 50 identifiable glomeruli in the antennal lobe and form synaptic connections with dendrites from 50 types of second-order projection neurons (PNs). Previous studies mainly focused on identifying important molecules that regulate the precise targeting in the olfactory circuit using fixed tissues. Here, an antennae-brain explant system that recapitulates key developmental milestones of olfactory circuit assembly in culture is described. Through dissecting the external cuticle and cleaning opaque fat bodies covering the developing pupal brain, high quality images of single neurons from live brains can be collected using two-photon microscopy. This allows time-lapse imaging of single ORN axon targeting from live tissue. This approach will help reveal important cell biological contexts and functions of previously identified important genes and identify mechanisms underpinning the dynamic process of circuit assembly.

An Explant System for Time-Lapse Imaging Studies of Olfactory Circuit Assembly in Drosophila

This protocol describes the dissection procedure, culture condition, and live imaging of an antennae-brain explant system for the study of the olfactory circuit assembly.

Drosophila'da Koku Alma Devresi Düzeneğinin Hızlandırılmış Görüntüleme Çalışmaları için Bir Explant Sistemi

~Neurons are precisely interconnected to form circuits essential for the proper function of the brain. The Drosophila olfactory system provides an ...

Gelişim Biyolojisi

Recording Temperature-induced Neuronal Activity through Monitoring Calcium Changes in the Olfactory Bulb of Xenopus laevis

The olfactory system, specialized in the detection, integration and processing of chemical molecules is likely the most thoroughly studied sensory system. However, there is piling evidence that olfaction is not solely limited to chemical sensitivity, but also includes temperature sensitivity. Premetamorphic Xenopus laevis are translucent animals, with protruding nasal cavities deprived of the cribriform plate separating the nose and the olfactory bulb. These characteristics make them well suited for studying olfaction, and particularly thermosensitivity. The present article describes the complete procedure for measuring temperature responses in the olfactory bulb of X. laevis larvae. Firstly, the electroporation of olfactory receptor neurons (ORNs) is performed with spectrally distinct dyes loaded into the nasal cavities in order to stain their axon terminals in the bulbar neuropil. The differential staining between left and right receptor neurons serves to identify the &#947;-glomerulus as the only structure innervated by contralateral presynaptic afferents. Secondly, the electroporation is combined with focal bolus loading in the olfactory bulb in order to stain mitral cells and their dendrites. The 3D brain volume is then scanned under line-illumination microscopy for the acquisition of fast calcium imaging data while small temperature drops are induced at the olfactory epithelium. Lastly, the post-acquisition analysis allows the morphological reconstruction of the thermosensitive network comprising the &#947;-glomerulus and its innervating mitral cells, based on specific temperature-induced Ca2+ traces. Using chemical odorants as stimuli in addition to temperature jumps enables the comparison between thermosensitive and chemosensitive networks in the olfactory bulb.

Recording Temperature-induced Neuronal Activity through Monitoring Calcium Changes in the Olfactory Bulb of Xenopus laevis

Here we describe a protocol for measuring and analyzing temperature responses in the olfactory bulb of Xenopus laevis. Olfactory receptor neurons and mitral cells are differentially stained, after which calcium changes are recorded, reflecting a sensitivity of some neural networks in the bulb to temperature drops induced at the nose.

koku ampul kalsiyum Değişiklikleri İzleme yoluyla Sıcaklık kaynaklı Nöronal Aktivite Kayıt<em&gt; Xenopus laevis</em

The olfactory system, specialized in the detection, integration and processing of chemical molecules is likely the most thoroughly studied sensory system. ...

Functional Evaluation of Olfactory Pathways in Living Xenopus Tadpoles

Xenopus tadpoles offer a unique platform to investigate the function of the nervous system. They provide multiple experimental advantages, such as accessibility to numerous imaging approaches, electrophysiological techniques and behavioral assays. The Xenopus tadpole olfactory system is particularly well suited to investigate the function of synapses established during normal development or reformed after injury. Here, we describe methodologies to evaluate the processing of olfactory information in living Xenopus larvae. We outline a combination of in vivo measurements of presynaptic calcium responses in glomeruli of the olfactory bulb with olfactory-guided behavior assays. Methods can be combined with the transection of olfactory nerves to study the rewiring of synaptic connectivity. Experiments are presented using both wild-type and genetically modified animals expressing GFP reporters in central nervous system cells. Application of the approaches described to genetically modified tadpoles can be useful for unraveling the molecular bases that define vertebrate behavior.

Functional Evaluation of Olfactory Pathways in Living Xenopus Tadpoles

Xenopus tadpoles offer a unique platform to investigate the function of the nervous system in vivo. We describe methodologies to evaluate the processing of olfactory information in living Xenopus larvae in normal rearing conditions or after injury.

Fonksiyonel yaşam Xenopus kurbağa yavrularını koku yollar değerlendirilmesi

Xenopus tadpoles offer a unique platform to investigate the function of the nervous system. They provide multiple experimental advantages, such as ...

Investigation of Activated Mouse Olfactory Sensory Neurons via Combined Immunostaining and in situ Hybridization

Animals rely on chemical communication to convey and perceive relevant environmental information, ranging from assessment of food quality to detection of available mating partners or threats. In mice, this task is executed primarily by the olfactory system and its underlying subsystems, including the main and accessory olfactory systems. Both have peripheral organs populated by sensory neurons expressing G-protein coupled receptors able to bind chemical cues that reach the nasal cavity. Even though the molecular characteristics of these receptors is well understood, little is known about their cognate specific ligands. The method described here combines in situ hybridization detection of olfactory or vomeronasal receptors with immunodetection of phosphorylated ribosomal protein S6 (pS6) - a marker of neuronal activation. This protocol was devised to identify neurons activated after a single event of exposure to purified or complex chemical stimuli detected by the olfactory organs. Importantly, this technique allows the investigation of neurons triggered in biologically relevant contexts. Ideally, this method should be used to probe the molecular biology of the olfactory system and to study olfactory behaviors.

Investigation of Activated Mouse Olfactory Sensory Neurons via Combined Immunostaining and in situ Hybridization

This protocol combines in situ hybridization with immunofluorescence to identify olfactory and vomeronasal receptor genes expressed in olfactory sensory neurons after activation by chemical stimuli in the mouse.

Animals rely on chemical communication to convey and perceive relevant environmental information, ranging from assessment of food quality to detection of ...

Koku Meşfatının Olfaktör Duyusal Akson Moleküler Kimlik Kodlarının Görselleştirilmesi İçin Dörtlü İmmün Sulanması

Özet

Daha Fazla Video Keşfet

Bu videodaki bölümler

Koku Duyu Nöronlar lentivirüs aracılı Genetik Manipülasyon ve Görselleştirme In vivo

Optik Yansıtma ve Otofloresans Sinyalleri kullanarak, Fare Koku Ampul Görüntüleme Koku-Uyarılmış Etkinlikler

Kronik Yetişkin doğmuş Koku Nöronlar Seçici Viral İletimi In vivo Optogenetic Uyarım

In Koku Reseptör Nöronlar Tüm Dağı ile immün

Bir Model Olarak Koku Sistemi Akson Büyüme Modelleri ve Morfoloji Eğitim için

Fareler Ana Koku Sistemde Cilia Whole Dağı Etiketleme

Drosophila'da Koku Alma Devresi Düzeneğinin Hızlandırılmış Görüntüleme Çalışmaları için Bir Explant Sistemi

koku ampul kalsiyum Değişiklikleri İzleme yoluyla Sıcaklık kaynaklı Nöronal Aktivite Kayıt

Fonksiyonel yaşam Xenopus kurbağa yavrularını koku yollar değerlendirilmesi

Investigation of Activated Mouse Olfactory Sensory Neurons via Combined Immunostaining and in situ Hybridization