Name: purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli
Uploaded: 2015-12-19T14:00:00.000+00:00
Duration: 9 min 43 s
Description: Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

1. Produção de plasmídeo e Shadoo Expressão Nota: O gene que codifica a proteína de murino Shadoo (Shadoo 25-122), foi subclonado no vector de expressão pET-28 11. Este clone foi usado para transformar E. SoluBL21 coli estirpe bacteriana, para expressar a proteína Shadoo com uma etiqueta de hexa-histidina N-terminal, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG), como explicado anteriormente 11. O plasmídeo pode ser solicitado dos autores. O peso molecular calculado a partir da Shadoo sua sequência de aminoácidos é 12,243.2 Da. Nota: Executar todas as manipulações com bactérias sob uma capela de fluxo laminal ou perto de Bunsen chama. <ol><li> Transformar bactérias competentes SoluBL21 com o pET-28-Sua 6 -Shadoo plasmídeo, usando um protocolo de choque térmico padrão. Para esta mistura de 1 a 5 ul do plasmídeo (tipicamente de 10 a 100 pgng) em 50 ul de as bactérias num tubo. Realizar a choque térmico a 42 ° C durante 45 seg. </li><li> Cultura de bactérias transformadas a 37 ° C até 600 um de 0,5-0,7 em meio de Luria Bertani suplementado com 40 mg / ml de canamicina (Figura 1B). </li><li> Shadoo induzir expressão O / N através da adição de 240 ug / ml de isopropil-β-D-tiogalactopiranósido, ITPG, para a cultura. As bactérias de cultura sob agitação a 150 rpm a 37 ° C. Nota: Normalmente, cultura bacteriana alcança A 600, de 3 de O / N. Nota: Transformado bactérias podem ser armazenadas a -80 ° C para a produção de proteína futuro. Para isso, adicionam-se 10% -50% (v / v) de glicerol estéril em alíquotas de culturas bacterianas e congelá-las a -80 ° C. </li></ol><img alt="figura 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> Figura 1. Esquema de Shadoo construção de expressão, transformação de bactérias e de indução de expressão Shadoo (tal como descrito no passo 1). </strong&gt; (A) A construção de expressão para Shadoo codifica uma marca de hexa-histidina fundida com o N-terminal da proteína, Nt. O esquema mostra que a proteína contém repetições Shadoo básicos arginina / glicina (cilindro verde), um domínio hidrófobo (HD), e um único local de N-glicosilação (CHO), seguido por um terminal-C (TC). (B) 28 pET-6-His -Shadoo plasmídeo é transformado em bactérias SoluBL21 por choque térmico durante 45 segundos a 42 ° C. Bactérias transformadas são plaqueadas em placas de agar selectivo que continha 40 ug / ml de canamicina. Uma única colónia da placa é utilizada para inocular um cultura num frasco agitador de 1.000-3.000 ml. A expressão da proteína recombinante é induzida com IPTG 1 mM. <a href="https://jove.unicartagenaproxy.elogim.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">Por favor clique aqui para ver uma versão maior desta figura.</a> 2. Purificação de Proteínas Shadoo por Cromatografia Líquida de Baixa Pressão (LPLC) <ol><li> A lise celular e Emcorpos conclusão preparação <ol><li> Recolha a suspensão bacteriana e transferi-la para dentro de tubos de centrifugação (Figura 2). </li><li> Rotação a 2.500 xg, durante 20 min a 4 ° C. Remover o sobrenadante por decantação e pelotas ressuspender em 15 ml de tampão (Tris 50 mM, EDTA 10 mM, pH 8, com anti-proteases) para cada sedimento derivado de 500 ml de cultura de células. Nota: Os sedimentos ressuspensos podem ser congeladas e armazenadas a -20 ° C durante vários dias. Congelamento facilita a lise de células bacterianas. </li><li> Verifique a sobre-expressão de proteína recombinante utilizando bactérias peletes bruto por análise de SDS-PAGE e coloração com Coomassie. <ol><li> Para isso, de centrífuga de 1 ml de cultura bacteriana para sedimentar as células. Adicionar 100 ul de solução de desnaturação de Laemmli (277,8 mM de Tris-HCl, pH 6,8, 4,4% de SDS, 44,4% w / v de glicerol, 0,02% azul de bromofenol) para sedimentar e aquece-se a 100 ° C durante 5 min. </li><li> Carga de 10 ul da amostra num gel de acrilamida a 12%, executar SDS-PAGE e visuAlize proteínas separado por coloração com Coomassie. </li></ol></li><li> Adicionar Triton X-100 a 0,5% de concentração final para o sedimento completamente ressuspenso de 2.1.2). </li><li> Incubar a suspensão em banho de água a 37 ° C durante 30 min. </li><li> Sonicar a suspensão durante 5 minutos a 6-12 microns amplitude pico-a-pico em água gelada para lisar células bacterianas. </li><li> Transferência suspensão sonicada em 50 ml de tubos de centrifugação limpas. </li><li> Tubos de centrifugação a 15.000 xg durante 15 min a 4 ° C. </li><li> Remover o sobrenadante por decantação e adicionam-se 5 ml de tampão de ligação (tampão de 20 mM de Tris-HCl, pH 7,4, NaCl 0,5 M, Ureia 8 M, 5 mM de imidazole) por tubo. </li><li> Colocar os tubos na roda girando O / N para proteínas a partir de corpos de inclusão voltar a suspender completamente. </li></ol><img alt="Figura 2" src="/files/ftp_upload/53432/53432fig2.jpg" /> Figura 2. Esquema de purificação de inclusãocorpos (tal como descrito no passo 2.1). transformadas que expressam Shadoo bactérias são colhidas por centrifugação e ressuspensas no tampão de lise. A suspensão é incubada a 37 ° C durante 30 min e, em seguida sonicada para romper mecanicamente células bacterianas. A sonicação é feito em gelo para evitar o aquecimento da amostra. Quebrados células são colhidas por centrifugação e ressuspensas num tampão contendo 8 M ureia para solubilizar proteínas a partir de corpos de inclusão. <a href="https://jove.unicartagenaproxy.elogim.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">Por favor clique aqui para ver uma versão maior desta figura.</a> </li><li> Cromatografia em Ni 2+ -affinity Nota: A cromatograf ia é realizada no FPLC usando um Sistema de Ni 2+ -charged, 5 ml de Sepharose quelante (Figura 3A). Todas as soluções são carregados na coluna com um caudal de 1 mL / min. <ol><li> Injectar 10 ml de solução 4 M Niso água de 0,2 para a coluna de Sepharose, a fim de carregá-lo-ions com Ni 2+. </li><li> Equilibrar a coluna carregada com Ni 2+ -ions por injecção de 30-50 ml de tampão de ligação contendo uma baixa concentração de imidazolo (tampão de 20 mM de Tris-HCl, pH 7,4, NaCl 0,5 M, Ureia 8 M, 5 mM de imidazole). </li><li> Coloque as proteínas solubilizadas-ureia com um dispositivo de injecção de 50 ml. </li><li> Recuperar a fracção de fluxo mediante a lavagem da coluna com 10 ml de tampão de baixa concentração de imidazole de ligação (tampão Tris-HCl a 20, pH 7,4, 0,5 M de NaCl, 8 M de ureia, mM de imidazole 5), a fim de remover um máximo de proteínas não ligadas a partir da coluna. </li><li> Lava-se a coluna com 50-100 ml do tampão de lavagem (20 mM Tris-HCl, pH 7,4, NaCl 0,5 M, ureia 8 M, imidazol 80 mM) para eluir as proteínas não especificamente ligadas à coluna. </li><li> Aplicar um gradiente linear de 15 min de imidazolo 80-800 mM no tampão contendo 20 mM de Tris-HCl, pH 7,4, NaCl 0,5 M, Ureia 8 M. Recolher fracções de 1 ml durante a aplicação do gradiente. Nota: proteínas-His-tag são eluídos sagacidadegradiente ha de tampão contendo imidazole (utilizado como competidor). </li><li> Tomar uma alíquota de 8 mL de cada fração e adicione 4 mL solução de desnaturação 4x Laemmli (ver 2.1.3.1). Soluções de aquecer a 100 ° C durante 5 min. </li><li> Carga de 10 ul de marcador de tamanho de proteína e 10 ul de cada amostra para o gel de acrilamida a 12%, executar SDS-PAGE e visualizar as proteínas separadas por coloração com Coomassie. Nota: O peso molecular calculado de Shadoo formar a sua sequência de aminoácidos é 12,243.2 Da. </li><li> Piscina todas as fracções contendo Shadoo. </li></ol><img alt="Figura 3" src="/files/ftp_upload/53432/53432fig3.jpg" /> Figura 3. Procedimento de purificação (tal como descrito nos passos 2,2-2,4). (A) Ni2 + -ions pode ser coordenado por resíduos de histidina, que permite a purificação selectiva de proteínas marcadas com poli-histidina. Imidazole é utilizado para eluir a proteína, atravéssua capacidade para coordenar com o Ni 2+ -ion e deslocar a proteína ligada. (B) As proteínas de diferentes raio hidrodinâmico que foram retidas na Ni 2+ -column são separados numa coluna de exclusão de tamanho. As proteínas são eluídas a partir da maior para os mais pequenos. (C) antes de usar, as fracções contendo Shadoo são reunidas e dessalinizadas para remover a ureia, imidazol e os seus sais. Os ensaios de controlo de qualidade incluem SDS-PAGE / coloração com Coomassie, Western blotting. Purificada Shadoo pode ser liofilizado. Liofilizado Shadoo é estável durante meses, quando armazenadas a -20 ° C. <a href="https://jove.unicartagenaproxy.elogim.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">Por favor clique aqui para ver uma versão maior desta figura.</a> </li><li> A cromatografia de exclusão de tamanho Nota: Um segundo passo de purificação consiste na cromatografia de exclusão de tamanho que separa proteína Shadoo das outras proteínas co-eluídas no primeiro passo de purificação(Figura 3B). <ol><li> Equilibrar coluna Superdex de 120 ml de volume total do leito através da injecção de 250 ml de tampão de 20 mM de Tris-HCl, pH 7,4, NaCl 0,5 M, Ureia 8 M a uma taxa de fluxo de 1,5 ml / min. </li><li> Carregar fracções reunidas contendo a partir de 2.2.9 Shadoo na coluna equilibrada. Recolher fracções de 1 ml após o volume vazio da coluna de 40 ml sobre o fluxo constante do tampão anterior. </li><li> Tomar uma aliquota de 10 ul de cada fracção e realização de uma análise de SDS-PAGE e coloração com Coomassie, tal como descrito acima para saber quais as fracções contêm Shadoo. </li><li> Piscina fracções contendo Shadoo. </li></ol></li><li> Dessalinização Nota: A dessalinização procedimento remove os sais, ureia e imidazole para se obter a proteína recombinante Shadoo num tampão adequado para estudos bioquímicos e biofísicos (Figura 3C). O mesmo resultado pode ser obtido por diálise contra o tampão de amostras. <ol><li> Equilibrar uma coluna de dessalinização de 53 ml com 150 mlde tampão de acetato de amónio 10 mM, pH 5, a uma taxa de fluxo de 5 ml / min. </li><li> Carga reunidas fracções Shadoo na coluna. Após a injecção do tampão acetato de amónio recolher manualmente fracções que mostram um aumento do sinal a 280 nm na saída do detector de UV. </li><li> Liofilizar a Shadoo dessalinizada e armazená-lo a -20 ° C. </li><li> Dissolver Shadoo liofilizado num tampão adequado, o tampão de acetato de sódio tal como 10 mM, pH 5, antes da utilização. Nota: A etiqueta de poli-histidina pode ser removida com enteroquinase. </li></ol></li></ol> 3. In Vitro Montagem dos Shadoo em amilóide fibrilas no pH fisiológico Nota: Os agregados proteicos Shadoo e espontaneamente forma fibrilhas a pH ≥ 7 11. <img alt="Figura 4" src="/files/ftp_upload/53432/53432fig4.jpg" /> Figura 4. Esquema da Shadoo redobragem para fibrilas amilóides (como descricama no passo 3). Purificada Shadoo converte-se espontaneamente para fibrilas amilóides quando dissolvido em tampão de pH 7. ≥ numa solução ácida, Shadoo converte em fibrilas amilóides após incubação com 1 M Gdn-HCl enquanto se agita. Os ensaios de controlo de qualidade incluem microscopia eletrônica e coloração TT. <a href="https://jove.unicartagenaproxy.elogim.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">Por favor clique aqui para ver uma versão maior desta figura.</a> <ol><li> Diluir Shadoo para uma concentração final de 2 ^ M num tampão 20 mM Tris-HCl, pH 7,4. Medir a concentração, medindo a densidade óptica da solução a 280 nm e utilizando o coeficiente de extinção deduzida a partir da composição de aminoácidos Shadoo de 20.970. </li><li> Incubar 500 ul da solução em um tubo de plástico cónico a 4 ° C durante um par de semanas, para permitir a conversão de proteína espontânea de estruturas amilóides (Figura 4). </li><li> Add preparados na hora tioflavina T (TT) para um conce definitivantration de 10 uM a uma alíquota de 100 ul da solução Shadoo. Incubar a solução durante 5 min à TA. Medir emissão de fluorescência a partir de 460 a 520 nm, utilizando um comprimento de onda de excitação de 435 nm, para verificar a presença de estruturas amilóides 17. </li></ol> 4. In Vitro Montagem dos Shadoo para amilóide fibrilas no ácida pHs <ol><li> Diluir Shadoo em 1 M GdnHCl, tampão de 20 mM de acetato de Na, pH de 5 a uma concentração final de 2 ^ M. </li><li> Incubar 500 ul desta solução num tubo cónico com agitação contínua a 37 ° C, durante 3-7 dias. </li><li> Verifique a presença de fibrilhas amilóides por adição de TT a uma alíquota da solução como em 3.3. </li><li> Dialisar suspensão obtida contra tampão de 10 mM de acetato de Na, pH 5,0, para purificar Shadoo fibrilas amilóides. </li><li> Armazenar fibrilas purificada a 4 ° C. </li></ol><img alt="Figura 5" src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; As fracções de proteína Figura 5. Os resultados representativos. Eluídas a partir da coluna carregada com Ni2 + quelante (A) e uma coluna de exclusão de tamanho (B) foram analisadas usando SDS-PAGE e coloração com Coomassie. Identificação de Shadoo purificada foi avaliada utilizando anticorpo anti-Shadoo SPRN (C). <a href="https://jove.unicartagenaproxy.elogim.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">Por favor clique aqui para ver uma versão maior desta figura.</a>

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

The authors have nothing to disclose.

Um protocolo de fácil e eficiente tanto para expressão e purificação de uma grande quantidade de proteína recombinante de ratinho Shadoo é apresentado. O método descrito permite a solubilização e purificação bem sucedida de (His 6) tagged Shadoo proteína recombinante. É importante, tal como referido no título, que quando expresso em uma bactéria procariota E. Shadoo coli acumula-se em corpos de inclusão. Antes da purificação Shadoo, as bactérias têm que ser lisadas por so...

Doenças neurodegenerativas causadas por príons, que incluem a encefalopatia espongiforme bovina em bovinos, scrapie em ovinos ea doença de Creutzfeldt-Jakob em humanos, são fatal e incurável. Prion doenças são caracterizadas por mudanças conformacionais da proteína príon celular composta principalmente de hélices, no-β-sheet cruz enriquecido amilóide conformer 1,2. Cross-beta-estruturas contêm densamente embalado e beta-folhas-cristalinos como altamente ordenadas estabilizado com ligações de hidrogênio 3,4. Amyloids Príon se auto-replicar devido aos beta-fios na borda crescente que fornecem um modelo para recrutar e converter uma unidade de proteína monomérica. De acordo com a hipótese do &quot;única proteína&quot;, o conformador de proteína amilóide prião é o agente infeccioso único. No entanto, algumas outras biomoléculas têm sido propostos como sendo essencial para distúrbios do prião. Por exemplo, as membranas celulares são pensados ​​para ser um lugar onde conversiocorre e em alguns lípidos carregados negativamente têm sido mostrados para melhorar o processo de conversão de 5,6. Além disso, algumas proteínas também podem estar envolvidos em patologias prião. Especificamente, existem dois outros membros da família de proteínas prião: Duplo e Shadoo 7,8. Doppel tem uma estrutura relativamente rígida estabilizado com pontes de di-sulfureto e não autopolimerização, e agregada para fibrilas amilóides 9. Em contraste, semelhante à da proteína do prião, Shadoo pode adoptar uma estrutura β folhas enriquecido e auto-associar-se em estruturas de fibrilas amilóides. Foi demonstrado que pode Shadoo fibrilar em condições nativas ou sobre as membranas carregadas negativamente 10,11 ligação. Conversão de Shadoo em fibras de amilóide-like pode ser associada com patologias. Com efeito, os mecanismos pelos quais as estruturas amilóides como causam a doença são mal compreendidos. Shadoo tem um domínio hidrofóbico (HD) e uma série de conjunto Arg / Gly repete t semelhanteO a parte N-terminal da proteína do prião (Figura 1A). À medida que a parte N-terminal da proteína do prião, Shadoo é altamente carregada positivamente e parece ser uma proteína nativa desestruturado 11,12. Shadoo parece ser funcionalmente relacionados com distúrbios do prião, uma vez que se pode ligar directamente a proteína prião. Além disso, a sua expressão é regulada negativamente durante prião patologia 13,14. No entanto, o papel de Shadoo na doença do prião ainda não foi estabelecido. Foi desenvolvido um plasmídeo que transporta a sequência de codificação do gene de rato Shadoo. O plasmídeo foi usado para transformar E. coli para a produção de N-terminal His Shadoo 6 fusão. Este sistema de expressão é bem estabelecida em nosso laboratório e é comumente usado em nossos projetos em andamento 6,15,16. Um problema importante para a expressão de Shadoo é a escolha da E. estirpe de E. coli. Enquanto BL21 competente estirpe bacteriana é geralmente utilizado para a expressão de pró recombinanteteínas Shadoo foi expressa e purificada a partir da estirpe única bacterianas transformadas com sucesso SoluBL21. SoluBL21 E. competente coli é um mutante melhorada da estirpe BL21 de acolhimento desenvolvido para a produção de proteínas cuja expressão na estirpe BL21-mãe deu nenhum produto detectável solúvel. Expressão de alto nível de Shadoo em SoluBL21 E. coli conduz a acumulação da proteína em corpos de inclusão. Como uma característica geral, quando uma proteína não nativa é altamente expressa em E. coli, esta proteína tende a acumular-se em corpos de inclusão insolúveis. Shadoo agrega provavelmente através de interacções não covalentes ou iónicas hidrofóbicas (ou uma combinação de ambos) para estruturas dinâmicas altamente enriquecidos formadas pela proteína dobrada para vários graus. Em consequência, a purificação compreende pelo menos dois passos: (i) uma separação selectiva da proteína a partir de outras biomoléculas em um meio de desnaturação, e (ii) uma renaturação da proteína purificada utilizando na dobragem in vitrotécnicas. A separação selectiva de Shadoo foi conseguida numa solução tampão contendo ureia 8M (ou, alternativamente, 6M guanidina-HCl). A remoção da ureia e a renaturação da proteína pode ser realizada por aplicação de vários protocolos de: (i) renaturação em uma solução de pH ácido para se obter uma proteína Shadoo monomérica desestruturado, ou (ii) renaturação em uma solução de pH ≥ 7 para se obter Shadoo polimerizado em fibras de amilóide estáveis ​​com motivos característicos cross-β-folha.

<table><tbody><tr><td>AKTA FPLC&amp;nbsp;</td><td>GE, Amersham</td><td># 1363</td><td></td></tr><tr><td>HiLoad 16/60 Superdex</td><td>GE Healthcare</td><td>17-1069-01</td><td></td></tr><tr><td>HiTrap IMAC</td><td>GE Healthcare</td><td>GE17-0920-05</td><td></td></tr><tr><td>HiPrep26/10 Desalting column</td><td>GE Healthcare</td><td>GE17-5087-01</td><td></td></tr><tr><td>SoluBL21 Competent E. coli</td><td>Genlantis</td><td>C700200</td><td></td></tr><tr><td>pET-28b+</td><td>Novogen</td><td>69865-3</td><td></td></tr><tr><td>IPTG</td><td>Sigma-Aldrich</td><td>I6758</td><td></td></tr><tr><td>LB-Broth medium</td><td>Sigma-Aldrich</td><td>L3022</td><td></td></tr><tr><td>Eppendorf Biophotometar</td><td>Eppendorf</td><td>550507804</td><td></td></tr><tr><td>Trito X-100</td><td>Life Technologies</td><td>85111</td><td></td></tr><tr><td>NiSO4</td><td>Sigma-Aldrich</td><td>656895</td><td></td></tr><tr><td>EDTA</td><td>Sigma-Aldrich</td><td>E6758</td><td></td></tr><tr><td>Tris-HCl</td><td>Sigma-Aldrich</td><td>RES3098T</td><td></td></tr><tr><td>Protease Inhibitor Cocktail Tablets</td><td>Roche</td><td>4693116001</td><td></td></tr><tr><td>NaCl</td><td>Sigma-Aldrich</td><td>746398</td><td></td></tr><tr><td>Imidazol</td><td>Sigma-Aldrich</td><td>I5513</td><td></td></tr><tr><td>Gdn-HCl</td><td>Sigma-Aldrich</td><td>G4505</td><td></td></tr><tr><td>protein size marker&amp;nbsp;</td><td>Thermo Fisher Scientific</td><td>26620</td><td></td></tr></tbody></table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

O sistema de expressão de Escherichia coli é uma ferramenta poderosa para a produção de proteínas eucarióticas recombinantes. Nós usá-lo para produzir Shadoo, uma proteína pertencente à família de prião. Um método de cromatografia para a purificação de (His) 6 tagged Shadoo recombinante expressa como corpos de inclusão é descrito. Os corpos de inclusão solubilizados em ureia 8 M e ligado a uma coluna de Ni 2+ -charged para realizar cromatografia de afinidade de iões. As proteínas ligadas são eluidas com um gradiente de imidazole. As fracções contendo proteína Shadoo são submetidas a cromatografia de exclusão de tamanho para obter uma proteína altamente purificada. No passo final é purificado Shadoo dessalinizada para remover os sais, ureia e imidazole. Shadoo proteína recombinante é um reagente importante para estudos bioquímicos e biofísicos de distúrbios conformação da proteína que ocorrem nas doenças de priões. Muitos relatórios demonstraram que as doenças neurodegenerativas priões são originários da deposição de facadale, ordenou fibrilas amilóides. Protocolos de exemplo que descrevem como fibrilar Shadoo em fibrilas amilóides no ácido e neutro / pHs básicos são apresentados. Os métodos de como produzir e fibrilar Shadoo pode facilitar a investigação em laboratórios que trabalham com doenças de príon, uma vez que permite a produção de grandes quantidades de proteína de uma maneira rápida e de baixo custo.

Cerca de 5-10 mg de proteína Shadoo purificado é obtido por litro de cultura bacteriana. A purificação em duas fases é necessário para obter Shadoo recombinante de elevado grau de pureza. A primeira etapa é realizada por cromatografia de afinidade com uma coluna de Ni 2+ -charged que conserva as suas-proteínas marcadas. As fracções eluídas são sujeitas a SDS-PAGE e corados com Coomassie Brilliant Blue (Figura 5A). As fracções que contêm proteína são reunidas e Shadoo adiciona...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

Purificação e redobramento de amilóide fibrilas de (seu)<sub&gt; 6</sub&gt; tagged proteína recombinante Shadoo Expresso como Corpos de Inclusão em<em&gt; E. coli</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his-6-tagged-recombinant

Universidad de Cartagena UDEC

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K visualizações.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

Vídeo: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

High Precision FRET at Single-molecule Level for Biomolecule Structure Determination

A protocol on how to perform high-precision interdye distance measurements using F&#246;rster resonance energy transfer (FRET) at the single-molecule level in multiparameter fluorescence detection (MFD) mode is presented here. MFD maximizes the usage of all &#34;dimensions&#34; of fluorescence to reduce photophysical and experimental artifacts and allows for the measurement of interdye distance with an accuracy up to ~1 &#197; in rigid biomolecules. This method was used to identify three conformational states of the ligand-binding domain of the N-methyl-D-aspartate (NMDA) receptor to explain the activation of the receptor upon ligand binding. When comparing the known crystallographic structures with experimental measurements, they agreed within less than 3 &#197; for more dynamic biomolecules. Gathering a set of distance restraints that covers the entire dimensionality of the biomolecules would make it possible to provide a structural model of dynamic biomolecules.

A protocol for high-precision FRET experiments at the single molecule level is presented here. Additionally, this methodology can be used to identify three conformational states in the ligand-binding domain of the N-methyl-D-aspartate (NMDA) receptor. Determining precise distances is the first step towards building structural models based on FRET experiments.

FRET de alta precisão em nível de molécula única para determinação de estrutura de biomoléculas

A protocol on how to perform high-precision interdye distance measurements using F&#246;rster resonance energy transfer (FRET) at the single-molecule ...

Bioquímica

From Constructs to Crystals &#8211; Towards Structure Determination of &#946;-barrel Outer Membrane Proteins

Membrane proteins serve important functions in cells such as nutrient transport, motility, signaling, survival and virulence, yet constitute only ~1% percent of known structures. There are two types of membrane proteins, &#945;-helical and &#946;-barrel. While &#945;-helical membrane proteins can be found in nearly all cellular membranes, &#946;-barrel membrane proteins can only be found in the outer membranes of mitochondria, chloroplasts, and Gram-negative bacteria. One common bottleneck in structural studies of membrane proteins in general is getting enough pure sample for analysis. In hopes of assisting those interested in solving the structure of their favorite &#946;-barrel outer membrane protein (OMP), general protocols are presented for the production of target &#946;-barrel OMPs at levels useful for structure determination by either X-ray crystallography and/or NMR spectroscopy. Here, we outline construct design for both native expression and for expression into inclusion bodies, purification using an affinity tag, and crystallization using detergent screening, bicelle, and lipidic cubic phase techniques. These protocols have been tested and found to work for most OMPs from Gram-negative bacteria; however, there are some targets, particularly for mitochondria and chloroplasts that may require other methods for expression and purification. As such, the methods here should be applicable for most projects that involve OMPs from Gram-negative bacteria, yet the expression levels and amount of purified sample will vary depending on the target OMP.

&#946;-barrel outer membrane proteins (OMPs) serve many functions within the outer membranes of Gram-negative bacteria, mitochondria, and chloroplasts. Here, we hope to alleviate a known bottleneck in structural studies by presenting protocols for the production of &#946;-barrel OMPs in sufficient quantities for structure determination by X-ray crystallography or NMR spectroscopy.

A partir de construções de Cristais - Rumo a determinação da estrutura de β-barril exterior Proteínas de Membrana

Membrane proteins serve important functions in cells such as nutrient transport, motility, signaling, survival and virulence, yet constitute only ~1% ...

Química

Method for Efficient Refolding and Purification of Chemoreceptor Ligand Binding Domain

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be greatly facilitated by the production of milligram amounts of pure, folded ligand binding domains. Attempts to heterologously express periplasmic ligand binding domains of bacterial chemoreceptors in Escherichia coli (E. coli) often result in their targeting into inclusion bodies. Here, a method is presented for protein recovery from inclusion bodies, its refolding and purification, using the periplasmic dCACHE ligand binding domain of Campylobacter jejuni (C. jejuni) chemoreceptor Tlp3 as an example. The approach involves expression of the protein of interest with a cleavable His6-tag, isolation and urea-mediated solubilisation of inclusion bodies, protein refolding by urea depletion, and purification by means of affinity chromatography, followed by tag removal and size-exclusion chromatography. The circular dichroism spectroscopy is used to confirm the folded state of the pure protein. It has been demonstrated that this protocol is generally useful for production of milligram amounts of dCACHE periplasmic ligand binding domains of other bacterial chemoreceptors in a soluble and crystallisable form.

A procedure is presented for the refolding of the dCACHE periplasmic ligand binding domain of Campylobacter jejuni chemoreceptor Tlp3 from inclusion bodies and the purification to yield milligram quantities of protein.

Método para dobrar eficiente e purificação do Chemoreceptor Ligand Binding Domain

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be ...

Purification and Aggregation of the Amyloid Precursor Protein Intracellular Domain

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a large extracellular domain and a short cytosolic domain termed the APP intracellular domain (AICD). During maturation through the secretory pathway, APP can be cleaved by proteases termed &alpha;, &beta;, and &gamma;-secretases1. Sequential proteolytic cleavage of APP with &beta; and &gamma;-secretases leads to the production of a small proteolytic peptide, termed A&beta;, which is amyloidogenic and the core constituent of senile plaques. The AICD is also liberated from the membrane after secretase processing, and through interactions with Fe65 and Tip60, can translocate to the nucleus to participate in transcription regulation of multiple target genes2,3. Protein-protein interactions involving the AICD may affect trafficking, processing, and cellular functions of holo-APP and its C-terminal fragments. We have recently shown that AICD can aggregate in vitro, and this process is inhibited by the AD-implicated molecular chaperone ubiquilin-14. Consistent with these findings, the AICD has exposed hydrophobic domains and is intrinsically disordered in vitro5,6, however it obtains stable secondary structure when bound to Fe657. We have proposed that ubiquilin-1 prevents inappropriate inter- and intramolecular interactions of AICD, preventing aggregation in vitro and in intact cells4. While most studies focus on the role of APP in the pathogenesis of AD, the role of AICD in this process is not clear. Expression of AICD has been shown to induce apoptosis8, to modulate signaling pathways9, and to regulate calcium signaling10. Over-expression of AICD and Fe65 in a transgenic mouse model induces Alzheimer's like pathology11, and recently AICD has been detected in brain lysates by western blotting when using appropriate antigen retrieval techniques12. To facilitate structural, biochemical, and biophysical studies of the AICD, we have developed a procedure to produce recombinantly large amounts of highly pure AICD protein. We further describe a method for inducing the in vitro thermal aggregation of AICD and analysis by atomic force microscopy. The methods described are useful for biochemical, biophysical, and structural characterization of the AICD and the effects of molecular chaperones on AICD aggregation.

A method for large-scale purification of the APP intracellular domain (AICD) is described. We also describe methodology to induce in vitro AICD aggregation and visualization by atomic force microscopy. The methods described are useful for biochemical/structural characterization of the AICD and the effects of molecular chaperones on its aggregation.

Purificação e Agregação do Domínio proteína precursora de amilóide intracelular

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a ...

Medicina

Synthesis of an Intein-mediated Artificial Protein Hydrogel

We present the synthesis of a highly stable protein hydrogel mediated by a split-intein-catalyzed protein trans-splicing reaction. The building blocks of this hydrogel are two protein block-copolymers each containing a subunit of a trimeric protein that serves as a crosslinker and one half of a split intein. A highly hydrophilic random coil is inserted into one of the block-copolymers for water retention. Mixing of the two protein block copolymers triggers an intein trans-splicing reaction, yielding a polypeptide unit with crosslinkers at either end that rapidly self-assembles into a hydrogel. This hydrogel is very stable under both acidic and basic conditions, at temperatures up to 50 &#176;C, and in organic solvents. The hydrogel rapidly reforms after shear-induced rupture. Incorporation of a &#34;docking station peptide&#34; into the hydrogel building block enables convenient incorporation of &#34;docking protein&#34;-tagged target proteins. The hydrogel is compatible with tissue culture growth media, supports the diffusion of 20 kDa molecules, and enables the immobilization of bioactive globular proteins. The application of the intein-mediated protein hydrogel as an organic-solvent-compatible biocatalyst was demonstrated by encapsulating the horseradish peroxidase enzyme and corroborating its activity.

We present the synthesis of a split-intein-mediated protein hydrogel. The building blocks of this hydrogel are two protein copolymers each containing a subunit of a trimeric protein that serves as a crosslinker and one half of a split intein. Mixing of the two protein copolymers triggers an intein trans-splicing reaction, yielding a polypeptide unit that self-assembles into a hydrogel. This hydrogel is highly pH- and temperature-stable, compatible with organic solvents, and easily incorporates functional globular proteins.

Síntese de uma proteína artificial intein mediada Hidrogel

We present the synthesis of a highly stable protein hydrogel mediated by a split-intein-catalyzed protein trans-splicing reaction. The building blocks of ...

Bioengenharia

Expression, Purification, Crystallization, and Enzyme Assays of Fumarylacetoacetate Hydrolase Domain-Containing Proteins

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this superfamily generally display multi-functionality, involving mainly hydrolase and decarboxylase mechanisms. This article presents a series of consecutive methods for the expression and purification of FAHD proteins, mainly FAHD protein 1 (FAHD1) orthologues among species (human, mouse, nematodes, plants, etc.). Covered methods are protein expression in E. coli, affinity chromatography, ion exchange chromatography, preparative and analytical gel filtration, crystallization, X-ray diffraction, and photometric assays. Concentrated protein of high levels of purity (&#62;98%) may be employed for crystallization or antibody production. Proteins of similar or lower quality may be employed in enzyme assays or used as antigens in detection systems (Western-Blot, ELISA). In the discussion of this work, the identified enzymatic mechanisms of FAHD1 are outlined to describe its hydrolase and decarboxylase bi-functionality in more detail.

Expression and purification of fumarylacetoacetate hydrolase domain-containing proteins is described with examples (expression in E. coli, FPLC). Purified proteins are used for crystallization and antibody production and employed for enzyme assays. Selected photometric assays are presented to display the multi-functionality of FAHD1 as oxaloacetate decarboxylase and acylpyruvate hydrolase.

Expressão, purificação, cristalização e ensaios enzimáticos de proteínas contendo domínio de Fumarilacetoacetato de hidrolase

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this ...

Targeting Cysteine Thiols for in Vitro Site-specific Glycosylation of Recombinant Proteins

Stromal interaction molecule-1 (STIM1) is a type-I transmembrane protein located on the endoplasmic reticulum (ER) and plasma membranes (PM). ER-resident STIM1 regulates the activity of PM Orai1 channels in a process known as store operated calcium (Ca2+) entry which is the principal Ca2+ signaling process that drives the immune response. STIM1 undergoes post-translational N-glycosylation at two luminal Asn sites within the Ca2+ sensing domain of the molecule. However, the biochemical, biophysical, and structure biological effects of N-glycosylated STIM1 were poorly understood until recently due to an inability to readily obtain high levels of homogeneous N-glycosylated protein. Here, we describe the implementation of an in vitro chemical approach which attaches glucose moieties to specific protein sites applicable to understanding the underlying effects of N-glycosylation on protein structure and mechanism. Using solution nuclear magnetic resonance spectroscopy we assess both efficiency of the modification as well as the structural consequences of the glucose attachment with a single sample. This approach can readily be adapted to study the myriad glycosylated proteins found in nature.

Targeting Cysteine Thiols for in Vitro Site-specific Glycosylation of Recombinant Proteins

Biochemical and structural analyses of glycosylated proteins require relatively large amounts of homogeneous samples. Here, we present an efficient chemical method for site-specific glycosylation of recombinant proteins purified from bacteria by targeting reactive Cys thiols.

Direcionamento de tióis cisteína para in Vitro site-specific glicosilação de proteínas recombinantes

Stromal interaction molecule-1 (STIM1) is a type-I transmembrane protein located on the endoplasmic reticulum (ER) and plasma membranes (PM). ER-resident ...

Imunologia e Infecção

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

Purificação da Hsp104, um Disaggregase Protein

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Biologia

Production of E. coli-expressed Self-Assembling Protein Nanoparticles for Vaccines Requiring Trimeric Epitope Presentation

Self-assembling protein nanoparticles (SAPNs) function as repetitive antigen displays and can be used to develop a wide range of vaccines for different infectious diseases. In this article we demonstrate a method to produce a SAPN core containing a six-helix bundle (SHB) assembly that is capable of presenting antigens in a trimeric conformation. We describe the expression of the SHB-SAPN in an E. coli system, as well as the necessary protein purification steps. We included an isopropanol wash step to reduce the residual bacterial lipopolysaccharide. As an indication of the protein identity and purity, the protein reacted with known monoclonal antibodies in Western blot analyses. After refolding, the size of the particles fell in the expected range (20 to 100 nm), which was confirmed by dynamic light scattering, nanoparticle tracking analysis, and transmission electron microscopy. The methodology described here is optimized for the SHB-SAPN, however, with only slight modifications it can be applied to other SAPN constructs. This method is also easily transferable to large scale production for GMP manufacturing for human vaccines.

Production of E. coli-expressed Self-Assembling Protein Nanoparticles for Vaccines Requiring Trimeric Epitope Presentation

A detailed method is provided here describing the purification, refolding, and characterization of self-assembling protein nanoparticles (SAPNs) for use in vaccine development.

Produção de E. coli-expressa auto-montagem de nanopartículas de proteína para vacinas que requerem Trimeric epitope apresentação

Self-assembling protein nanoparticles (SAPNs) function as repetitive antigen displays and can be used to develop a wide range of vaccines for different ...

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures of polypeptides fulfill many purposes, it is now recognized that most proteins can adopt an alternative assembly of beta-sheet rich amyloid. Insoluble amyloid fibrils are initially associated with multiple human ailments, but they are increasingly shown as functional players participating in various important cellular processes. In addition, amyloid deposited in patient tissues contains nonproteinaceous components, such as nucleic acids and glycosaminoglycans (GAGs). These cofactors can facilitate the formation of amyloid, resulting in the generation of different types of insoluble precipitates. By taking advantage of our understanding how proteins misfold via an intermediate stage of soluble amyloid precursor, we have devised a method to convert native proteins to amyloid fibrils in vitro. This approach allows one to prepare amyloid in large quantities, examine the properties of amyloid generated from specific proteins, and evaluate the structural changes accompanying the conversion.

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins can either adopt a native structure or misfold into insoluble amyloid. Conditions that favor the misfolding pathway lead to the formation of different types of amyloid fibrils. The methods described here allow rapid conversion of native proteins into amyloid in vitro.

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures ...

Purificação e redobramento de amilóide fibrilas de (seu)

Resumo

Explore mais vídeos

Capítulos neste vídeo

FRET de alta precisão em nível de molécula única para determinação de estrutura de biomoléculas

A partir de construções de Cristais - Rumo a determinação da estrutura de β-barril exterior Proteínas de Membrana

Método para dobrar eficiente e purificação do Chemoreceptor Ligand Binding Domain

Purificação e Agregação do Domínio proteína precursora de amilóide intracelular

Síntese de uma proteína artificial intein mediada Hidrogel

Expressão, purificação, cristalização e ensaios enzimáticos de proteínas contendo domínio de Fumarilacetoacetato de hidrolase

Direcionamento de tióis cisteína para in Vitro site-specific glicosilação de proteínas recombinantes

Purificação da Hsp104, um Disaggregase Protein

Produção de E. coli-expressa auto-montagem de nanopartículas de proteína para vacinas que requerem Trimeric epitope apresentação

Rapid Generation of Amyloid from Native Proteins In vitro