עבודת מחקר שבוצעה במעבדה נתמכה על ידי מענקי קרן המחקר - פלנדריה (FWO; מספרי מענק G.0545.08 וG.0298.11), תכנית הפולנים המשיכה הבינאוניברסיטאי (מדיניות מדע בלגית; מענק מספר P6/28 וP7/13) ומוטבע בקהילת מחקר FWO נתמכת. CDH הוא פוסט דוקטורט של קרן המחקר - פלנדריה (FWO). המחברים מודים מאוד לכל חברי ההווה ובעבר של המעבדה של איתות מולקולרית ותאית (KU לובן), ד&quot;ר SP Srinivas (אוניברסיטת אינדיאנה הספר לאופטומטריה, ארה&quot;ב), המעבדה של ד&quot;ר Leybaert (אוניברסיטת גנט) ושל ד&quot;ר Vinken (Vub) שסיפק דיונים מועילים, מותאם נהלים או היו מעורב בפיתוח כלים לחקר hemichannels connexin.

1. בידוד של תאי אנדותל הקרניים לפני שיתחיל: לבודד את התאים מהעיניים טריות, המתקבלות מהמטבחיים מקומי, בהקדם האפשרי לאחר enucleating העין. ודא כי העין הייתה enucleated מפרה של בן 18 חודשים, חמש פוסט המורט והשתמרו בתמיסת מלח מאוזנת של ארל דקות מקסימליים - תמיסת יוד 1% ב 4 ° C להובלה למעבדה. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> קח עין מתמיסת מלח מאוזנת של ארל - תמיסת יוד 1% ולמקם אותו בצלחת פטרי (100 מ&quot;מ X 20). </li><li style=";text-align:right;direction:rtl"> לעקר את העין עם תמיסה המכילה 70% אתנול ולשטוף עם תמיסת מלח מאוזנת של ארל המכילה 1% יוד. </li><li style=";text-align:right;direction:rtl"> משלב זה ואילך, לעבוד במנדף סטרילי. בזהירות לנתח את הקרנית מהעין ולמקם אותו בצלחת פטרי (35 x 10 מ&quot;מ) המכילה תמיסת מלח מאוזנת של ארל, עם שכבת תאי האפיתל פונה כלפי מעלה. להסיר כל Sti רקמת איריס שנותר בזהירותיהיה מחובר לקרנית במידת צורך. </li><li style=";text-align:right;direction:rtl"> העבר את הקרנית לתמיסת מלח מאוזנת של ארל אחר המכילה צלחת פטרי עם שכבת תאי האנדותל כלפי מעלה ולשטוף פעמיים עם תמיסת מלח מאוזנת של ארל. </li><li style=";text-align:right;direction:rtl"> העבר את הקרנית עם שכבת האנדותל פונה כלפי מעלה לשעון חול, שהוא מאכל בצורת כוס, ולכסות אותו עם מדיום גידול. מדיום הגידול מורכב מבינוני השתנה Dulbecco של הנשר המכיל גלוקוז 25 מ&quot;מ, 10% בסרום שור עוברי, 6.6% L-גלוטמין, 2.5 מיקרוגרם / מיליליטר amphotericin-B ו 1% תערובת האנטיביוטיקה antimycotic המכיל 10,000 יחידות / מ&quot;ל ​​של פניצילין, 10,000 מיקרוגרם / מ&quot;ל ​​של סטרפטומיצין, ו -25 מיקרוגרם / מיליליטר amphotericin B. </li><li style=";text-align:right;direction:rtl"> הסר את המדיום עם טפטפת יניקה. </li><li style=";text-align:right;direction:rtl"> החל μl 300 של פתרון טריפסין (0.5 גר &#39;/ ל&#39;) לשכבת האנדותל של הקרנית (כל הצעדים הכוללים טריפסין נעשים באמצעות אותו הריכוז). </li><li style=";text-align:right;direction:rtl"> הנח את שעון חול המכיל את הקרנית בצלחת פטרי מכוסה ושם אותו בincubator למשך 30 דקות בשעה 37 ° C ו 5% CO 2. </li><li style=";text-align:right;direction:rtl"> בעדינות לגרד את תאי האנדותל מקרנית עם זכוכית פיפטה פסטר בצורת וו אש מלוטשת בשכונת סטרילי. </li><li style=";text-align:right;direction:rtl"> תמצוץ את התמיסה המכילה את תאי האנדותל ולהוסיף אותו לתרבות צלוחיות (25 ס&quot;מ 2) המכילות 4 מ&quot;ל של מדיום התרבות. </li><li style=";text-align:right;direction:rtl"> החל μl 300 של מדיום גידול לקרנית וחזור גירוד ולהוסיף תמיסה המכילה את תאי האנדותל לבקבוק התרבות. </li><li style=";text-align:right;direction:rtl"> חזור על שלב זה סופי (1.11) פעם נוספת. </li><li style=";text-align:right;direction:rtl"> הנח את תרבות צלוחיות המכילים את תאי האנדותל בקרנית במדיום הגידול בחממה ב 37 ° C ו 5% CO 2. </li><li style=";text-align:right;direction:rtl"> לאחר יומיים, להוסיף 6 מ&quot;ל של מדיום התרבות. </li><li style=";text-align:right;direction:rtl"> רענן מדיום גידול כל יום שני. </li></ol> 2. תרבית תאים <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> הסר את מדיום התרבות לשטוף את התאים פעמיים עם הפתרון של ארל מאוזן מלח, כאשר confluency הוא הגיע (באבו10 ימים לאחר בידוד t). </li><li style=";text-align:right;direction:rtl"> הוסף פתרון 1.5 מ&quot;ל טריפסין לתאים כדי לנתק אותם ומניחים את הבקבוק בחממה (37 מעלות צלזיוס, 5% CO 2) במשך 3 עד 4 דקות. </li><li style=";text-align:right;direction:rtl"> הוסף 12 מ&quot;ל של מדיום גידול. פיפטה שלוש הפעמים בינוניות פנימה והחוצה כדי לפזר את התאים ולספור את התאים. </li><li style=";text-align:right;direction:rtl"> תאי זרע עם חלק קטן משתנה בהתאם לצפיפות התא ולשים אותם בחממה. הכן שתי שקופיות היטב בליעה (בשטח של 4.2 ס&quot;מ 2) עם ספירת תאים של 165,000 תאים (תא לצפיפות 39,286 2 ס&quot;מ). הכן 80 ס&quot;מ 2 צלוחיות תרבות למעבר חדש בצפיפות של 6,250 ל2 ס&quot;מ, ולהוסיף מדיום התרבות טרי עד נפח כולל של 25 מ&quot;ל. </li><li style=";text-align:right;direction:rtl"> רענן בינונית כל יומיים. </li><li style=";text-align:right;direction:rtl"> Confluency של שכבת התאים הוא הגיע לאחר 3 עד 4 ימים. להשתמש בתאים לניסויים. </li><li style=";text-align:right;direction:rtl"> כאשר confluency של שכבת התאים בצלוחיות הוא הגיע, חזור על שלבי 2.1-2.6. ניתן להשתמש בתרביות תאים עד חלוף 2 Fאו ניסויים. </li></ol> 3. גירוי מכאני לגל סיד התרמה <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לטעון את התאים בשקופית הקבורים עם 10 מיקרומטר Fluo-4 בבוקר בפוספט שנאגרו מלוח למשך 30 דקות ב 37 מעלות צלזיוס בזמן הטלטול בעדינות. </li><li style=";text-align:right;direction:rtl"> הסר Fluo-04:00 פתרון, לשטוף את התאים חמש פעמים עם פוספט שנאגרו מלוח, דגירה התאים עם פוספט שנאגרו מלוח ולהשאיר את התאים לפחות 5 דקות בטמפרטורת חדר לפני המדידה. </li><li style=";text-align:right;direction:rtl"> אקסייט ב 488 ננומטר עם ארגון לייזר ושימוש קורה המפצל HFT 488, לאסוף את פליטת הקרינה ב530 ננומטר באמצעות longpass פליטת מסנן LP 505, קבע את חריר במינימום. השתמש אובייקטיבי 40X טבילת שמן (אוויר, 1.2 NA). בניסויים עם ARL-67156, השתמש אובייקטיבי 10X (אוויר, 0.3 NA). </li><li style=";text-align:right;direction:rtl"> לחפש תחום שבו התאים ומחוברות במיקרוסקופ confocal. </li><li style=";text-align:right;direction:rtl"> עמדת פיפטה כך שזה ב 45 מעלות ביחס לשקופית הבליעה ונוגע בקרום התא.לעורר גירוי מכאני קצר (≈ 1 שניות) לתא בודד. הגירוי מכאני מורכב מעיוות חריפה, קצר טווח של התא על ידי נגיעה פחות מ -1% של קרום התא בקצרה עם micropipette כוס (קוטר קצה &lt;1 מיקרומטר) מצמידים את nanopositioner גביש פיזואלקטריים, המופעל באמצעות מגבר שהוא רכוב על מיקרו מניפולטור. את micropipettes עשוי הזכוכית עם חולץ microelectrode. ודא כי nanopositioner מופעל על ידי מתח בין 0.2 ו 1.5 V במהלך הגירוי מכאני. מתח גבוה מ -1.5 וולט יכול לגרום לניזק לתאים. לכל סוג תא ולמצבו, המתח האופטימלי לגירוי מכאני ללא נזק לתאים צריך להיקבע בזהירות על ידי יישום שורה של מתחים החל מ נמוך (0.2 וולט) למתח גבוה (1.5 וולט). המתח הוא מדד לעוצמת הגירוי שכן מתח זה קובע את הלחץ מכאני ומתח שמוחלים על קרום התא.כוח של הגירוי מכאני יכול להיות מחושב על ידי הכפלת הלחץ מכאני עם האזור. מאז הן האזור (&lt;3.14 מיקרומטר 2) ולחץ מכאני הם נמוכים מאוד, כוח של הגירוי מכאני הוא נמוך. (שים לב שכאשר תא פגום, דליפות הקרינה אל מחוץ לתא והתא הופכים כהות.) </li><li style=";text-align:right;direction:rtl"> למדוד שינויים מרחביים ב[ Ca 2 +] אני בעקבות גירוי מכאני עם מיקרוסקופ confocal. </li><li style=";text-align:right;direction:rtl"> לאסוף ולאחסן את תמונות. </li><li style=";text-align:right;direction:rtl"> צייר אזור polygonal עניין להגדיר את שטח הפנים הכולל של תאים מגיבים (האזור פעיל, א.א.) באמצעות התוכנה של מיקרוסקופ confocal. </li></ol>

יש מחברים אין לחשוף.

בכתב יד זה, אנו מתארים שיטה פשוטה למדידת 2 + אינטר התפשטות גל CA בmonolayers של תאי האנדותל בקרנית שור ראשוניים על ידי מתן גירוי מכאני מקומית ומבוקר באמצעות micropipette. תאי מגורה מכאני מגיבים בעלייה מקומית בIP תאי 3 וCa 2 +, אשר שניהם הם מולקולות איתות תאיות חיוניות...

תקשורת בין תאית ואיתות חיונית לתיאום של תהליכים פיסיולוגיים בתגובה לאגוניסטים תאיים ברמה 1,2 כל האיבר והרקמה. הדרך הישירה ביותר של תקשורת בין תאית נוצרה על ידי ההתרחשות של צמתים פער. צמתים פער הם לוחות של ערוצי צומת גאפ, שהם ערוצים חלבוניים שהוקמו על ידי העגינה הראש בראש של שתי connexin (CX) hemichannels של תאים סמוכים 3,4 (איור 1). צמתים פער לאפשר המעבר של מולקולות איתות קטנות עם משקל מולקולרי של פחות מ -1.5 kDa, כולל Ca 2 + או ה-IP של 3 5, מה שגרם וויסות Ca 2 + שחרור מהחנויות תאיות של התאים השכנים 6 (איור 2). ערוצי צומת פער מוסדרים היטב על ידי אינטראקציות חלבון ותוך מולקולאריים ועל ידי תהליכי איתות תאיים, כמו שינוי והחיזורזירחון 7. GJS להקל על התגובה מתואמת של תאים מחוברים, ובכך מתנהג כמו כימי וsyncytium חשמל. לדוגמה, הפצה של פוטנציאל פעולת לב על פני myocytes פרוזדורים וחדרים מתווכת על ידי ערוצי 85 GJ מבוסס CX. CXS יש לא רק תפקיד כערוצי צומת פער, אלא גם ליצור hemichannels מזווג, ובכך מתפקד כערוצים בקרום בדומה לערוצים רגילים יון 8-10 (איור 1). Hemichannels להשתתף באיתות בין תאים שכנים paracrine על ידי שליטה בחילופי יונים ומולקולות איתות בין סביבת התוך תאית ו. בסוגי תאים רבים (כמו תאי אפיתל, תאי osteoblastic, האסטרוציטים, תאי אנדותל, וכו &#39;) ואיברים (כמו מוח, כבד, רשתית, שבלול וכלי דם), אינטר Ca 2 + גלים הם יסוד לתיאום של תגובות תאיות <sup&gt; 11. עליות בCa 2 + רמות תאיות בתא מסוים אינן מוגבלות לתא זה, אבל להפיץ לתאים השכנים בסביבה, וכך לבסס Ca אינטר 2 + גל 12,13. Ca 2 + אלה אינטר גלים חשובים לויסות פיזיולוגית נורמלית של שכבות תאים כsyncytium וdysregulation נקשר עם תהליכי pathophysiological 11. באנדותל ואפיתל קרני, קבוצות שונות 14-24, כולל 25-33 משלנו, חקרו את המנגנונים ואת התפקידים של תקשורת בין תאית. בתאים שאינם נרגשים, כמו תאי אנדותל בקרנית, שני מצבים שונים של תקשורת בין תאית להתרחש 28,29, כלומר פער תקשורת בין תאית junctional ותקשורת בין תאית paracrine. תקשורת בין תאית junctional פער כרוכה בחילופים ישירים של מולקולות איתות דרך צמתים פער 7. פער juncתקשורת בין תאית tional היא קריטית לשמירה על הומאוסטזיס רקמות, השליטה התפשטות תאים, והקמה מסונכרנת תגובה ללחץ תאי 10,34,35. במספר פתולוגיות, צימוד צומת פער מצטמצם עקב פגום CXS, ומשפיע על פער תקשורת בין תאית 36 junctional בזאת. זה מדגיש את החשיבות והשפעה של תקשורת בין תאית junctional פער באורגניזמים תאיים. בניגוד לתקשורת בין תאית junctional פער, תקשורת בין תאית paracrine אינה תלויה בפרד תאי תאים, שכן היא כוללת את שחרורו של שליחים תאיים diffusible (איור 2). סוגים שונים של מולקולות איתות משתחררים בחלל החוץ התאי על ידי תאי איתות. המולקולה לאחר מכן הועברה לתא היעד שבו הוא זוהה על ידי חלבון קולטן ספציפי. כתוצאה מכך מורכבת קולט האותות גורם לתגובה תאית, אשרהוא הופסק על ידי הסרת האות, איון או הפחתת רגישות. שליחים תאיים lipophilic פורסם איתות לחדור את הקרום ולפעול על קולטני תאיות. בניגוד לכך, שליחים הידרופילי לא לחצות את קרום הפלזמה של התא להגיב, אבל לפעול כיגנד שנקשר לחלבוני פני שטח, הביעו הקולטן, אשר לאחר מכן להעביר את האות לסביבה תאית. שלוש משפחות עיקריות של חלבונים פני תא קולטן להשתתף בתהליך הזה: קשור יון ערוצים, אנזים צמוד וצמוד לחלבון G. מולקולת השליח שוחרר יכולה לפעול על הקולטנים של אותו התא (autocrine), על תאי המטרה בסמיכות (paracrine), או על תאי היעד רחוקים שדורשים מערכת הדם (האנדוקרינית). בסוגי תאים רבים, כולל קרנית האנדותל 28,29, ה-ATP הוא אחד הגורמים העיקריים paracrine הידרופילי, המניעים את ההתפשטות של אינטר Ca 2 + גלים 37-40. משךעיוות מכאנית ing, היפוקסיה, דלקת או גירוי על ידי סוכנים שונים, ניתן לשחרר ATP מהתאים בריאים 41-44 בתגובה למאמץ גזירה, מתיחה, או נפיחות האוסמוטי 44,45. מנגנוני ה-ATP-הפצה אחרות כבר הניחו, כולל exocytosis לפוחי 44 ושפע של מנגנוני הובלה, כגון ה-ATP מחייבים קלטות (ABC) מובילים, ערוצי אניון מתח התלויים plasmalemmal 46, P2X7 ערוצי קולט 47,48, כמו גם connexin hemichannels 49-52 וpannexin hemichannels 43,49,53. ATP תאי יכול להיות במהירות הידרוליזה לADP, AMP ואדנוזין 54,55 ידי ectonucleotidases שנמצאים בסביבה תאית. ה-ATP שפורסם extracellularly וADP המטבוליט שלה 56 תהיה להפיץ באמצעות דיפוזיה. האינטראקציה הבאה של נוקלאוטידים אלה עם קולטני purinergic בתאים השכנים הייתה מעורבת בעמ &#39;ropagation של אינטר Ca 2 + גלים 28,37,51. שני סוגים של קולטנים שונים purinergic נוכחים: אדנוזין הוא ליגנד הטבעי העיקרי לP1-purinoceptors, בעוד הן פורין (ATP, ADP) ופירימידין (UTP, UDP) נוקלאוטידים ביותר לפעול על P2-purinoceptors 57. תקשורת בין תאית יכולה להיחקר על ידי שיטות שונות כגון טעינה לגרד, העברת צבע, משחררות רפרוף מקומית של אגוניסטים כמו IP 3 וCa 2 +, גירוי מכאני, וכו &#39;. כאן אנו מתארים את המחקר של Ca 2 + התפשטות גל שהושרו על ידי גירוי מכאני של תא בודד. היתרון של לימוד 2 + התפשטות גל CA על ידי גירוי מכאני הוא שהיא מספקת כלי קל לכמת את התפשטות Ca 2 + גל לאורך זמן, והיא מאפשרת השוואת כמותית pretreatments של התאים שונים. באנדותל בקרנית, אלה Ca 2 + אינטר גלים לאפשר שיתוףתגובה מתואמת מmonolayer, מתנהגת בזאת כמנגנון הגנה אפשרי של האנדותל של הקרנית שאינם משובי עוזרים האנדותל לעמוד לחצים תאיים במהלך ניתוח תוך עיני, או בחשיפה למתווכים דלקתיים במהלך דחייה של מערכת חיסון או אובאיטיס 58,59.

<table border="1">
<tbody>
 <tr>
 <td>Name of Reagent/Material</td>
 <td>Company</td>
 <td>Catalog Number</td>
 <td>Column1</td>
 </tr>
 <tr>
 <td>Earle's Balanced Salt Solution (EBSS)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14155-048</td>
 <td></td>
 </tr>
 <tr>
 <td>Iodine</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>38060-1EA</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's Modified Eagle's Medium (DMEM)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>11960-044</td>
 <td></td>
 </tr>
 <tr>
 <td>L-glutamine (Glutamax)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>35050-038</td>
 <td></td>
 </tr>
 <tr>
 <td>Amphotericin-B</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A2942</td>
 <td></td>
 </tr>
 <tr>
 <td>Antibiotic-antimycotic mixture</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>15240-096</td>
 <td></td>
 </tr>
 <tr>
 <td>Trypsin</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>25300-054</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's PBS</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14190-091</td>
 <td></td>
 </tr>
 <tr>
 <td>Fluo-4 AM</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>F14217</td>
 <td></td>
 </tr>
 <tr>
 <td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A265</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VI</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6410</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VII</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6535</td>
 <td></td>
 </tr>
 <tr>
 <td>Gap26 (VCYDKSFPISHVR)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Gap27 (SRPTEKTIFII)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Control Peptide (SRGGEKNVFIV)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td></td>
 <td></td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Two chambered glass slides</td>
 <td>Laboratory-Tek Nunc (Roskilde, Denmark)</td>
 <td>155380</td>
 <td></td>
 </tr>
 <tr>
 <td>Confocal microscope </td>
 <td>Carl Zeiss Meditec (Jena, Germany)</td>
 <td>LSM510</td>
 <td></td>
 </tr>
 <tr>
 <td>Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>P-280</td>
 <td></td>
 </tr>
 <tr>
 <td>HVPZT-amplifier</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>E463 HVPZT-amplifier</td>
 <td></td>
 </tr>
 <tr>
 <td>Glass tubes (glass replacement 3.5 nanoliter)</td>
 <td>World Precision Instruments, Inc. Sarasota, Florida, USA</td>
 <td>4878</td>
 <td></td>
 </tr>
 <tr>
 <td>Microelectrode puller </td>
 <td>Zeitz Instrumente (Munchen, Germany)</td>
 <td>WZ DMZ-Universal Puller</td>
 <td></td>
 </tr>
</tbody>
 </table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

תקשורת בין תאית היא חיונית לתיאום של תהליכים פיסיולוגיים בין תאים במגוון רחב של איברים ורקמות, ובכלל זה המוח, הכבד, הרשתית, השבלול וכלי הדם. בהגדרות ניסוי, אינטר Ca 2 + גלים יכול להיות שהושרו על ידי יישום גירוי מכאני לתא בודד. זה מוביל לשחרור של מולקולות האיתות תאיות IP 3 ו Ca 2 + שיזמו את ההתפשטות של Ca 2 + גל מעגלי מתא מגורה מכאני לתאים השכנים. את המסלולים המולקולריים המרכזיים השולטים 2 התפשטות אינטר + גל Ca מסופקים על ידי ערוצי צומת פער עד להעברה הישירה של 3-IP ועל ידי hemichannels דרך שחרורו של ה-ATP. זיהוי והאפיון של המאפיינים והרגולציה של connexin שונה וisoforms pannexin כערוצי צומת גאפ וhemichannels מותר על ידי quantification של התפשטות Ca אינטר 2 + גל, siRNA, ושימוש במעכבים של ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידה אינטר Ca 2 + גל בmonolayers של תאי האנדותל בקרנית עיקריים עמוסים Fluo4-AM בתגובה לגירוי מכאני מבוקר ומקומי עורר על ידי עיוות חריפה, קצר טווח של התא כתוצאה נגיעה של קרום התא עם micropipette זכוכית micromanipulator שליטה בקוטר קצה מיקרומטר פחות מ 1. אנו גם מתארים את הבידוד של תאים ראשוניים שור קרנית האנדותל והשימוש בו כמערכת מודל להערכת פעילות Cx43-hemichannel ככוח מונע לאינטר Ca 2 + גלים דרך שחרורו של ה-ATP. לבסוף, אנו דנים בשימוש, יתרונות, מגבלות וחלופות של שיטה זו בהקשר של ערוץ צומת פער ומחקר hemichannel.

כל הניסויים מבוצעים בעמידה בכל ההנחיות הרלוונטיות, תקנות וגופים הרגולטוריים ואת הפרוטוקול שמפגינים מבוצע תחת הדרכתו ואישורו של הטיפול בבעלי החיים ועדת שימוש בלובן KU. בתאי אנדותל בקרנית שור (BCEC), צמתים פער תפקודיים באים לידי ביטו...

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Ca אינטר<sup&gt; 2 +</sup&gt; גלים מונעים על ידי ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידת Ca אינטר<sup&gt; 2 +</sup&gt; גלים בmonolayers הסלולרי בתגובה לגירוי מכאני מתא בודד מקומי והיישום שלה כדי לחקור את המאפיינים והרגולציה של ערוצי צומת גאפ וhemichannels.

הרבייה מכאנית מושרה גירוי סיד גל בmonolayers הסלולרי: דוגמה לתאי אנדותל קרני שור

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Universidad de Cartagena UDEC

Research

JoVE Journal

Biology

16.2K Views.  KU Leuven. Ca אינטר 2 + גלים מונעים על ידי ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידת Ca אינטר 2 + גלים בmonolayers הסלולרי בתגובה לגירוי מכאני מתא בודד מקומי והיישום שלה כדי לחקור את המאפיינים והרגולציה של ערוצי צומת גאפ וhemichannels.

Video: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Propagation of Human Embryonic Stem (ES) Cells

Propagation of Human Embryonic Stem ES Cells

Yeah, so I'm Lauren Deon. I'm in charge of the Human Amgen stem cell co facility at MGH. Yeah, so I'm Lauren, I'm in charge of the Human AM stem cell co facility at MGH.So I've been working with human Amgen stem cells for years now since I was a postdoc in George De Lab before, from four, four years. And so right now we have two cell lines, H one and H nine, which are both from Y cell. And so the way we are expanding or maintaining these cells in culture is by, at least the way we are splitting these cells is by using collagenous.So what I usually do is for the first few passage after throwing the cells, I use a technical, the picking colonies. So in this case, I can check under the microscope which colonies are good and differentiate and nice shape, and I will collect only these colonies and I will cut them in few pieces and put them back in, in a fresh flat. And the, the colonies that look kind of differentiate it are just left them alone.The other way to pass the cells is by using trypsin. So I don't use this technique here. I think collagenase is a little bit safer because human being stem cells don't like to be individualized or they don't like to be alone.So if you do trypsin, if you use trypsin for a little bit too long, if you use it for like three to four minutes, which is the way we use strips in for other type of cells, human stem cells will be individualized and most of them will die or just differentiate or will not attach to the myth. So the idea is you have to keep the cells as clumps. You don't want them to be alone in the in, in the flask.So using collagenase, the advantage is to keep cells as plants. Using chipsy, you just select for cells that will survive this very, very harsh process of g opsonization. So these cells are usually very highly proliferative.So you get, you can adapt your cells to this tripsin process. The problem is that you have cells that they behave differently, they go much faster. And one risk is that you can get some commercial abnormality to, to this, to this very high division process.So you say that ization can cause selection of cells in culture for most proliferative cells.Right. More ative and probably also higher survival rates than other cells. So after proliferation, basically culture after proliferation in tripsin, after several passages become a different culture, these different properties.So it's, it's hard to figure out if they are exactly identical. If you do the test, the usual test, let's say you check markers, regular markers of end differentiated cells like OC four, nano one 60 SC four C, C3, all this molecule might still be expressed. If you do TER formation, this cells might still differentiate and be formed like al like normal cells.If you look at the karyotype, you might have some abnormality, but you might still have a normal karyotype. The, the, the selective advantage might be due to just a mutation that you cannot see by doing a karyotype. So the fact that they grow much faster is by itself I think a little bit worser.And if we want to use these cells for transplantation at some point, I would definitely not use this type of cells.Okay. So would you like to tell me what are the main technical problems with using this technique for, for passages of cells? So using S, yes.It's just a little bit longer and also it's, since the cells are not going as fast, it's just much longer to get a high number of cells to do some experiment. So it's just less convenient I would say. Would you like to tell me about few words about the goals of your experiment?How do you use CS cells? Okay, so my main project here is to get endothelial cells from human AB stem cells. And the idea is to be able to make blood.And we are working a lot with tissue bioengineering labs and one of their goal is to make tissue in vitro. But one of the limitation to this is the lack of blood vessels going through this tissues. So if we can bring endothelial cells or put endothelial cells in this tissue, we would have better growth of this tissue.So the idea few sources of cells are known for endothelial cells like cold blood or pressure blood, but it would be interesting to have another source of cells like human years. And the advantage is since human years can be expanded and most infinitely, you could modify these cells, make some inducible system and be able to use it. Then in your final product, your material cells, in this case.

רביה של האדם גזע עובריים (ES) תאים

Isolation and Large Scale Expansion of Adult Human Endothelial Colony Forming Progenitor Cells

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult human peripheral blood within a mean of 12 days. After large scale expansion &gt;1x108 ECFCs can be obtained for further tests. Advantageously by using pHPL the contact of human cells with bovine serum antigens can be excluded. By flow cytometry and immunohistochemistry the isolated cells can be characterized as ECFC and their in vitro functionality to form vascular like structures can be tested in a matrigel assay. Further these cells can be subcutaneously injected in a mouse model to form functional, perfused vessels in vivo. After long term expansion and cryopreservation proliferation, function and genomic stability appear to be preserved. 3,4
This animal-protein free isolation and expansion method is easily applicable to generate a large quantity of ECFCs.

Endothelial colony forming progenitor cells (ECFCs) are a promising tool to study vascular homeostasis and repair.1,2 This paper introduces a novel animal-serum free method for isolation and expansion of ECFC from heparinised adult human peripheral blood with pooled human platelet lysate (pHPL) diminishing the risk of anti-bovine immunisation.

בידוד הרחבת בקנה מידה גדול של תאים אנושיים למבוגרים האנדותל המושבה יצירת אב

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult ...

Isolation of Valvular Endothelial Cells

Heart valves are solely responsible for maintaining unidirectional blood flow through the cardiovascular system. These thin, fibrous tissues are subjected to significant mechanical stresses as they open and close several billion times over a lifespan. The incredible endurance of these tissues is due to the resident valvular endothelial (VEC) and interstitial cells (VIC) that constantly repair and remodel in response to local mechanical and biological signals. Only recently have we begun to understand the unique behaviors of these cells, for which in vitro experimentation has played a key role. Particularly challenging is the isolation and culture of VEC. Special care must be used from the moment the tissue is removed from the host through final plating. Here we present protocols for direct isolation, side specific isolation, culture, and verification of pure populations of VEC. We use enzymatic digestion followed by a gentle swab scraping technique to dislodge only surface cells. These cells are then collected into a tube and centrifuged into a pellet. The pellet is then resuspended and plated into culture flasks pre-coated with collagen I matrix. VEC phenotype is confirmed by contact inhibited growth and the expression of endothelial specific markers such as PECAM1 (CD31), Von Willebrand Factor (vWF), and negative expression of alpha-smooth muscle actin (&alpha;-SMA). The functional characteristics of VEC are associated with high levels of acetylated LDL. Unlike vascular endothelial cells, VEC have the unique capacity to transform into mesenchyme, which normally occurs during embryonic valve formation1. This can also occur during significantly prolonged post confluent in vitro culture, so care should be made to passage at or near confluence. After VEC isolation, pure populations of VIC can then be easily acquired.

We provide a method for isolating and culturing pure populations of heart valve endothelial cells (VEC). VEC can be isolated from either side of the cusp or leaflet and immediately following, underlying interstitial cell (VIC) isolation is straightforward.

בידוד של תאים אנדותל valvular

Heart valves are solely responsible for maintaining unidirectional blood flow through the cardiovascular system.  These thin, fibrous tissues are ...

Assessment of Calcium Sparks in Intact Skeletal Muscle Fibers

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in the striated muscle fibers that appear as highly localized Ca2+ release events mediated by ryanodine receptor (RyR) Ca2+ release channels on the sarcoplasmic reticulum (SR) membrane. Proper assessment of muscle Ca2+ sparks could provide information on the intracellular Ca2+&#160;handling properties of healthy and diseased striated muscles. Although Ca2+ sparks events are commonly seen in resting cardiomyocytes, they are rarely observed in resting skeletal muscle fibers; thus there is a need for methods to generate and analyze sparks in skeletal muscle fibers.
Detailed here is an experimental protocol for measuring Ca2+ sparks in isolated flexor digitorm brevis (FDB) muscle fibers using fluorescent Ca2+ indictors and laser scanning confocal microscopy. In this approach, isolated FDB fibers are exposed to transient hypoosmotic stress followed by a return to isotonic physiological solution. Under these conditions, a robust Ca2+ sparks response is detected adjacent to the sarcolemmal membrane in young healthy FDB muscle fibers. Altered Ca2+ sparks response is detected in dystrophic or aged skeletal muscle fibers. This approach has recently demonstrated that membrane-delimited signaling involving cross-talk between inositol (1,4,5)-triphosphate receptor (IP3R) and RyR contributes to Ca2+ spark activation in skeletal muscle. In summary, our studies using osmotic stress induced Ca2+ sparks showed that this intracellular response reflects a muscle signaling mechanism in physiology and aging/disease states, including mouse models of muscle dystrophy (mdx mice) or amyotrophic lateral sclerosis (ALS model).

Described here is a method to directly measure calcium sparks, the elementary units of Ca2+ release from sarcoplasmic reticulum&#160;in intact skeletal muscle fibers. This method utilizes osmotic-stress-mediated triggering of Ca2+ release from ryanodine receptor in isolated muscle fibers. The dynamics and homeostatic capacity of intracellular Ca2+ signaling can be employed to assess muscle function in health and disease.

הערכה של סידן ניצוצות בסיבי שריר שלד שלמים

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in ...

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using this protocol, angiogenesis may be measured in vitro in a fast, quantifiable manner. Primary or immortalized endothelial cells are mixed with conditioned media and plated on basement membrane matrix. The endothelial cells form capillary like structures in response to angiogenic signals found in conditioned media. The tube formation occurs quickly with endothelial cells beginning to align themselves within 1&#160;hr and lumen-containing tubules beginning to appear within 2 hr. Tubes can be visualized using a phase contrast inverted microscope, or the cells can be treated with calcein AM prior to the assay and tubes visualized through fluorescence or confocal microscopy. The number of branch sites/nodes, loops/meshes, or number or length of tubes formed can be easily quantified as a measure of in vitro angiogenesis. In summary, this assay can be used to identify genes and pathways that are involved in the promotion or inhibition of angiogenesis in a rapid, reproducible, and quantitative manner.

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

The tube formation assay is a fast, quantifiable method for measuring in vitro angiogenesis. Endothelial cells are combined with conditioned media and plated on basement membrane extract. Tube formation occurs within hours and newly formed tubules easily quantified.

Assay היווצרות צינור תא האנדותל ל<em&gt; במבחנה</em&gt; חקר אנגיוגנזה

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using ...

Analysis of Oxidative Stress in Zebrafish Embryos

High levels of reactive oxygen species (ROS) may cause a change of cellular redox state towards oxidative stress condition. This situation causes oxidation of molecules (lipid, DNA, protein) and leads to cell death. Oxidative stress also impacts the progression of several pathological conditions such as diabetes, retinopathies, neurodegeneration, and cancer. Thus, it is important to define tools to investigate oxidative stress conditions not only at the level of single cells but also in the context of whole organisms. Here, we consider the zebrafish embryo as a useful in vivo system to perform such studies and present a protocol to measure in vivo oxidative stress. Taking advantage of fluorescent ROS probes and zebrafish transgenic fluorescent lines, we develop two different methods to measure oxidative stress in vivo: i) a &#8220;whole embryo ROS-detection method&#8221; for qualitative measurement of oxidative stress and ii) a &#8220;single-cell&#160;ROS detection method&#8221; for quantitative measurements of oxidative stress. Herein, we demonstrate the efficacy of these procedures by increasing oxidative stress in tissues by oxidant agents and physiological or genetic methods. This protocol is amenable for forward genetic screens and it will help address cause-effect relationships of ROS in animal models of oxidative stress-related pathologies such as neurological disorders and cancer.

Here we report a protocol to measure oxidative stress in living zebrafish embryos. This procedure allows reactive oxygen species (ROS) detection in both whole embryo tissues and single-cell populations. This protocol will accomplish both qualitative and quantitative analyses.

ניתוח של סטרס חמצוני בעוברי דג הזברה

High levels of reactive oxygen species (ROS) may cause a change of cellular redox state towards oxidative stress condition. This situation causes ...

Measuring the Osmotic Water Permeability Coefficient (Pf) of Spherical Cells: Isolated Plant Protoplasts as an Example

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is a simple and very efficient method for the determination of the osmotic water permeability coefficient (Pf) in plant protoplasts, applicable in principle also to other spherical cells such as frog oocytes. The first step of the assay is the isolation of protoplasts from the plant tissue of interest by enzymatic digestion into a chamber with an appropriate isotonic solution. The second step consists of an osmotic challenge assay: protoplasts immobilized on the bottom of the chamber are submitted to a constant perfusion starting with an isotonic solution and followed by a hypotonic solution. The cell swelling is video recorded. In the third step, the images are processed offline to yield volume changes, and the time course of the volume changes is correlated with the time course of the change in osmolarity of the chamber perfusion medium, using a curve fitting procedure written in Matlab (the &#8216;PfFit&#8217;), to yield Pf.

Measuring the Osmotic Water Permeability Coefficient Pf of Spherical Cells: Isolated Plant Protoplasts as an Example

Measuring the osmotic water permeability coefficient (Pf) of cells can help understand the regulatory mechanisms of aquaporins (AQPs). Pf determination in spherical plant cell protoplasts presented here involves protoplasts isolation and numerical analysis of their initial rate of volume change as a result of an osmotic challenge during constant bath perfusion.

מדידת אוסמוטי המים החדירות מקדם (P<sub&gt; F</sub&gt;) של תאים כדוריים: Protoplasts צמח מבודד כדוגמה

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is ...

Isolation of Murine Valve Endothelial Cells

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and surrounded by a monolayer of valve endothelial cells (VECs). VECs play essential roles in establishing the valve structures during embryonic development, and are important for maintaining life-long valve integrity and function. In contrast to a continuous endothelium over the surface of healthy valve leaflets, VEC disruption is commonly observed in malfunctioning valves and is associated with pathological processes that promote valve disease and dysfunction. Despite the clinical relevance, focused studies determining the contribution of VECs to development and disease processes are limited. The isolation of VECs from animal models would allow for cell-specific experimentation. VECs have been isolated from large animal adult models but due to their small population size, fragileness, and lack of specific markers, no reports of VEC isolations in embryos or adult small animal models have been reported. Here we describe a novel method that allows for the direct isolation of VECs from mice at embryonic and adult stages. Utilizing the Tie2-GFP reporter model that labels all endothelial cells with Green Fluorescent Protein (GFP), we have been successful in isolating GFP-positive (and negative) cells from the semilunar and atrioventricular valve regions using fluorescence activated cell sorting (FACS). Isolated GFP-positive VECs are enriched for endothelial markers, including CD31 and von Willebrand Factor (vWF), and retain endothelial cell expression when cultured; while, GFP-negative cells exhibit molecular profiles and cell shapes consistent with VIC phenotypes. The ability to isolate embryonic and adult murine VECs allows for previously unattainable molecular and functional studies to be carried out on a specific valve cell population, which will greatly improve our understanding of valve development and disease mechanisms.

The ability to isolate heart valve endothelial cells (VECs) is critical for understanding mechanisms of valve development, maintenance, and disease. Here we describe the isolation of VECs from embryonic and adult Tie2-GFP mice using FACS that will allow for studies determining the contribution of VECs in developmental and disease processes.

בידוד של תאי Murine Valve האנדותל

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and ...

Quantitation of Endothelial Cell Adhesiveness In Vitro

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This occurs when endothelial cells, which line blood vessels, become adhesive to circulating immune cells such as monocytes. In vitro measurement of this adhesiveness has until now been done by quantifying the total number of monocytes that adhere to an endothelial layer either as a direct count or by indirect measurement of the fluorescence of adherent monocytes. While such measurements do indicate the average adhesiveness of the endothelial cell population, they are confounded by a number of factors, such as cell number, and do not reveal the proportion of endothelial cells that are actually adhesive. Here we describe and demonstrate a method which allows the enumeration of adhesive cells within a tested population of endothelial monolayer. Endothelial cells are grown on glass coverslips and following desired treatment are challenged with monocytes (that may be fluorescently labeled). After incubation, a rinsing procedure, involving multiple rounds of immersion and draining, the cells are fixed. Adhesive endothelial cells, which are surrounded by monocytes are readily identified and enumerated, giving an adhesion index that reveals the actual proportion of endothelial cells within the population that are adhesive.

Quantitation of Endothelial Cell Adhesiveness In Vitro

We report an in vitro method that allows the quantitation of the actual number of adhesive cells within an endothelial cell monolayer.

כימות של דביקות תא האנדותל<em&gt; במבחנה</em

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This ...

Isolation and Primary Culture of Mouse Aortic Endothelial Cells

The vascular endothelium is essential to normal vascular homeostasis. Its dysfunction participates in various cardiovascular disorders. The mouse is an important model for cardiovascular disease research. This study demonstrates a simple method to isolate and culture endothelial cells from the mouse aorta without any special equipment. To isolate endothelial cells, the thoracic aorta is quickly removed from the mouse body, and the attached adipose tissue and connective tissue are removed from the aorta. The aorta is cut into 1 mm rings. Each aortic ring is opened and seeded onto a growth factor reduced matrix with the endothelium facing down. The segments are cultured in endothelial cell growth medium for about 4 days. The endothelial sprouting starts as early as day 2. The segments are then removed and the cells are cultured continually until they reach confluence. The endothelial cells are harvested using neutral proteinase and cultured in endothelial cell growth medium for another two passages before being used for experiments. Immunofluorescence staining indicated that after the second passage the majority of cells were double positive for Dil-ac-LDL uptake, Lectin binding, and CD31 staining, the typical characteristics of endothelial cells. It is suggested that cells at the second to third passages are suitable for in vitro and in vivo experiments to study the endothelial biology. Our protocol provides an effective means of identifying specific cellular and molecular mechanisms in endothelial cell physiopathology.

The vascular endothelial cells play a significant role in many important cardiovascular disorders. This article describes a simple method to isolate and expand endothelial cells from the mouse aorta without using any special equipment. Our protocol provides an effective means of identifying mechanisms in endothelial cell physiopathology.

בידוד והתרבות ראשית של לתאי אנדותל עכבר אב העורקים

The vascular endothelium is essential to normal vascular homeostasis. Its dysfunction participates in various cardiovascular disorders. The mouse is an ...

הרבייה מכאנית מושרה גירוי סיד גל בmonolayers הסלולרי: דוגמה לתאי אנדותל קרני שור

Summary

Explore More Videos

Chapters in this video